LYPLA1 Antibody - #DF3737
![](/images/pubmed.gif)
Product: | LYPLA1 Antibody |
Catalog: | DF3737 |
Description: | Rabbit polyclonal antibody to LYPLA1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 25 KD; 25kD(Calculated). |
Uniprot: | O75608 |
RRID: | AB_2836101 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3737, RRID:AB_2836101.
Fold/Unfold
Acyl protein thioesterase 1; Acyl-protein thioesterase 1; APT 1; APT-1; APT1; hAPT1; LPL-I; LPL1; LYPA1_HUMAN; LYPLA 1; LYPLA1; Lysophospholipase 1; Lysophospholipase I; Lysophospholipid specific lysophospholipase; LYSOPLA; LysoPLA I;
Immunogens
- O75608 LYPA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75608 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K97 | Ubiquitination | Uniprot | |
K105 | Ubiquitination | Uniprot | |
K190 | Ubiquitination | Uniprot | |
S209 | Phosphorylation | Uniprot | |
S210 | Phosphorylation | Uniprot | |
C211 | S-Nitrosylation | Uniprot | |
K224 | Ubiquitination | Uniprot |
Research Backgrounds
Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity.
Cytoplasm.
Homodimer.
Belongs to the AB hydrolase superfamily. AB hydrolase 2 family.
Research Fields
· Human Diseases > Cancers: Overview > Choline metabolism in cancer. (View pathway)
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
References
Application: WB Species: Mouse Sample: renal medulla
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.