ACOT8 Antibody - #DF3736
| Product: | ACOT8 Antibody |
| Catalog: | DF3736 |
| Description: | Rabbit polyclonal antibody to ACOT8 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 36 KD; 36kD(Calculated). |
| Uniprot: | O14734 |
| RRID: | AB_2836100 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3736, RRID:AB_2836100.
Fold/Unfold
ACTEIII; Acot8; ACOT8_HUMAN; Acyl CoA thioesterase 8; Acyl-CoA thioesterase 8; Acyl-coenzyme A thioesterase 8; Choloyl coenzyme A thioesterase; Choloyl-coenzyme A thioesterase; hACTE III; hACTE-III; hACTEIII; HIV Nef associated acyl CoA thioesterase; HIV-Nef-associated acyl-CoA thioesterase; HNAACTE; hTE; Long chain fatty acyl CoA hydrolase; Palmitoyl CoA hydrolase; Peroxisomal acyl CoA thioesterase 1; Peroxisomal acyl coenzyme A thioester hydrolase 1; Peroxisomal acyl-coenzyme A thioester hydrolase 1; Peroxisomal long chain acyl CoA thioesterase 1; Peroxisomal long-chain acyl-CoA thioesterase 1; PTE 1; PTE 2; PTE-1; PTE-2; PTE1; PTE2; Thioesterase II;
Immunogens
A synthesized peptide derived from human ACOT8, corresponding to a region within the internal amino acids.
Detected in a T-cell line (at protein level). Ubiquitous (PubMed:9153233, PubMed:9299485).
- O14734 ACOT8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acyl-coenzyme A (acyl-CoA) thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Acyl-coenzyme A thioesterase 8/ACOT8 display no strong substrate specificity with respect to the carboxylic acid moiety of Acyl-CoAs (By similarity). Hydrolyzes medium length (C2 to C20) straight-chain, saturated and unsaturated acyl-CoAS but is inactive towards substrates with longer aliphatic chains. Moreover, it catalyzes the hydrolysis of CoA esters of bile acids, such as choloyl-CoA and chenodeoxycholoyl-CoA and competes with bile acid CoA:amino acid N-acyltransferase (BAAT) (By similarity). ACOT8 is also able to hydrolyze CoA esters of dicarboxylic acids (By similarity). It is involved in the metabolic regulation of peroxisome proliferation.
(Microbial infection) May mediate Nef-induced down-regulation of CD4 cell-surface expression.
Peroxisome matrix.
Note: Predominantly localized in the peroxisome but a localization to the cytosol cannot be excluded.
Detected in a T-cell line (at protein level). Ubiquitous.
Belongs to the C/M/P thioester hydrolase family.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
· Metabolism > Lipid metabolism > Primary bile acid biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.