ABHD6 Antibody - #DF3720
| Product: | ABHD6 Antibody |
| Catalog: | DF3720 |
| Description: | Rabbit polyclonal antibody to ABHD6 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 38 KD; 38kD(Calculated). |
| Uniprot: | Q9BV23 |
| RRID: | AB_2836084 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3720, RRID:AB_2836084.
Fold/Unfold
0610041D24Rik; 2 arachidonoylglycerol hydrolase; AA673485; Abhydrolase domain containing 6; Abhydrolase domain containing protein 6; AV065425; Llipase protein; MGC94917;
Immunogens
- Q9BV23 ABHD6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BV23 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K126 | Ubiquitination | Uniprot | |
| K136 | Ubiquitination | Uniprot | |
| K189 | Ubiquitination | Uniprot | |
| K223 | Ubiquitination | Uniprot | |
| K265 | Ubiquitination | Uniprot | |
| K267 | Ubiquitination | Uniprot | |
| K276 | Ubiquitination | Uniprot |
Research Backgrounds
Lipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol. Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways (By similarity). Also has a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids (By similarity). Also able to degrade bis(monoacylglycero)phosphate (BMP) and constitutes the major enzyme for BMP catabolism. BMP, also known as lysobisphosphatidic acid, is enriched in late endosomes and lysosomes and plays a key role in the formation of intraluminal vesicles and in lipid sorting.
Late endosome membrane>Single-pass type II membrane protein. Lysosome membrane>Single-pass type II membrane protein. Mitochondrion membrane>Single-pass type II membrane protein.
Belongs to the AB hydrolase superfamily.
Research Fields
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.