Mammaglobin B Antibody - #AF0203
Product: | Mammaglobin B Antibody |
Catalog: | AF0203 |
Description: | Rabbit polyclonal antibody to Mammaglobin B |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 15kDa; 11kD(Calculated). |
Uniprot: | O75556 |
RRID: | AB_2833287 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0203, RRID:AB_2833287.
Immunogens
Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
- O75556 SG2A1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
PTMs - O75556 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T73 | Phosphorylation | Uniprot | |
Y85 | Phosphorylation | Uniprot |
Research Backgrounds
May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
Secreted.
Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
Heterodimer of a lipophilin A and a lipophilin C (mammaglobin B) monomer associated head to head.
Belongs to the secretoglobin family. Lipophilin subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.