AGPAT4 Antibody - #DF3640
Product: | AGPAT4 Antibody |
Catalog: | DF3640 |
Description: | Rabbit polyclonal antibody to AGPAT4 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 44 KD; 44kD(Calculated). |
Uniprot: | Q9NRZ5 |
RRID: | AB_2836012 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3640, RRID:AB_2836012.
Fold/Unfold
1 acyl sn glycerol 3 phosphate acyltransferase delta; 1 acylglycerol 3 phosphate O acyltransferase 4; 1 AGP acyltransferase 4; 1 AGPAT4; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta); 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; AGPAT4; dJ473J16.2; LPAAT delta; LPAAT-delta; Lysophosphatidic acid acyltransferase delta; Lysophosphatidic acid acyltransferase-delta (LPAAT-delta); PLCD_HUMAN; RP3 473J16.2;
Immunogens
Widely expressed with highest levels in skeletal muscle, followed by heart, liver, prostate and thymus.
- Q9NRZ5 PLCD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NRZ5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K87 | Ubiquitination | Uniprot | |
S188 | Phosphorylation | Uniprot | |
K201 | Ubiquitination | Uniprot | |
S223 | Phosphorylation | Uniprot | |
Y226 | Phosphorylation | Uniprot | |
K281 | Ubiquitination | Uniprot | |
S332 | Phosphorylation | Uniprot | |
S334 | Phosphorylation | Uniprot | |
S335 | Phosphorylation | Uniprot | |
S365 | Phosphorylation | Uniprot | |
Y367 | Phosphorylation | Uniprot |
Research Backgrounds
Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone (By similarity). Exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, especially docosahexaenoyl-CoA (22:6-CoA, DHA-CoA) (By similarity).
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Widely expressed with highest levels in skeletal muscle, followed by heart, liver, prostate and thymus.
The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Research Fields
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.