RAD51L1 Antibody - #DF3629
Product: | RAD51L1 Antibody |
Catalog: | DF3629 |
Description: | Rabbit polyclonal antibody to RAD51L1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Monkey |
Prediction: | Rabbit |
Mol.Wt.: | 40~50KD; 42kD(Calculated). |
Uniprot: | O15315 |
RRID: | AB_2836001 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3629, RRID:AB_2836001.
Fold/Unfold
DNA repair protein RAD51 homolog 2; hREC2; MGC34245; OTTHUMP00000212251; OTTHUMP00000212253; OTTHUMP00000212254; OTTHUMP00000212255; R51H2; RA51B_HUMAN; RAD51 homolog B (S. cerevisiae); RAD51 homolog B; RAD51 like 1; RAD51 like protein 1; RAD51-like protein 1; Rad51B; RAD51L1; REC2; RecA like protein; Recombination repair protein;
Immunogens
- O15315 RA51B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O15315 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T66 | Phosphorylation | Uniprot | |
K71 | Ubiquitination | Uniprot | |
K176 | Ubiquitination | Uniprot | |
K202 | Ubiquitination | Uniprot | |
K229 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway.
Phosphorylated on tyrosine residues by BCR-ABL.
Nucleus.
Expressed in a wide range of tissues.
Part of the BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2; the complex has a ring-like structure arranged into a flat disc around a central channel. The BCDX2 subcomplex RAD51B:RAD51C interacts with RAD51. Interacts with SWSAP1; involved in homologous recombination repair.
Belongs to the RecA family. RAD51 subfamily.
Research Fields
· Genetic Information Processing > Replication and repair > Homologous recombination.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.