IL20RB Antibody - #DF3603
Product: | IL20RB Antibody |
Catalog: | DF3603 |
Description: | Rabbit polyclonal antibody to IL20RB |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 35 KD; 35kD(Calculated). |
Uniprot: | Q6UXL0 |
RRID: | AB_2835975 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3603, RRID:AB_2835975.
Fold/Unfold
DIRS1; Fibronectin type III domain containing 6; FNDC6; I20RB_HUMAN; IL 20R beta; IL 20R2; IL-20 receptor subunit beta; IL-20R-beta; IL-20R2; IL-20RB; IL20RB; Interleukin 20 receptor beta; Interleukin 20 receptor beta chain precursor; Interleukin 20 receptor II; Interleukin-20 receptor subunit beta; MGC34923;
Immunogens
Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin.
- Q6UXL0 I20RB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVMSPEELLRAWIS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q6UXL0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K204 | Ubiquitination | Uniprot | |
S280 | Phosphorylation | Uniprot | |
K283 | Ubiquitination | Uniprot |
Research Backgrounds
The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.
Membrane>Single-pass type I membrane protein.
Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin.
Heterodimer with IL20RA and heterodimer with IL22RA1.
Belongs to the type II cytokine receptor family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.