Product: Cytochrome P450 27A1 Antibody
Catalog: DF3571
Description: Rabbit polyclonal antibody to Cytochrome P450 27A1
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Dog
Mol.Wt.: 60 KD(Observed); 60kD(Calculated).
Uniprot: Q02318
RRID: AB_2835943

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Dog(82%)
Clonality:
Polyclonal
Specificity:
Cytochrome P450 27A1 Antibody detects endogenous levels of total Cytochrome P450 27A1.
RRID:
AB_2835943
Cite Format: Affinity Biosciences Cat# DF3571, RRID:AB_2835943.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

12-alpha-triol 27-hydroxylase; 5-beta-cholestane-3-alpha; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase; 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase; 7-alpha; Cholestanetriol 26 monooxygenase; CP27; CP27A_HUMAN; CTX; CYP; CYP27; CYP27A1; Cytochrome P 450C27/25; Cytochrome P-450C27/25; Cytochrome P450 27; Cytochrome P450 27 mitochondrial; Cytochrome P450 family 27 subfamily A polypeptide 1; Cytochrome P450 subfamily XXVIIA (steroid 27-hydroxylase cerebrotendinous xanthomatosis) polypeptide 1; mitochondrial; Sterol 26 hydroxylase; Sterol 26 hydroxylase mitochondrial; Sterol 26-hydroxylase; Sterol 27 hydroxylase; Sterol 27-hydroxylase; Vitamin D(3) 25 hydroxylase; Vitamin D(3) 25-hydroxylase;

Immunogens

Immunogen:

A synthesized peptide derived from human Cytochrome P450 27A1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q02318 CP27A_HUMAN:

Expressed in the neural retina and underlying retinal pigment epithelium (at protein level) (PubMed:21411718). Expressed in the gray and white matter of cerebellum (at protein level) (PubMed:28190002).

Sequence:
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
82
Horse
73
Pig
64
Bovine
64
Sheep
64
Chicken
64
Rabbit
64
Xenopus
55
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Cytochrome P450 monooxygenase that catalyzes regio- and stereospecific hydroxylation of cholesterol and its derivatives. Hydroxylates (with R stereochemistry) the terminal methyl group of cholesterol side-chain in a three step reaction to yield at first a C26 alcohol, then a C26 aldehyde and finally a C26 acid. Regulates cholesterol homeostasis by catalyzing the conversion of excess cholesterol to bile acids via both the 'neutral' (classic) and the 'acid' (alternative) pathways. May also regulate cholesterol homeostasis via generation of active oxysterols, which act as ligands for NR1H2 and NR1H3 nuclear receptors, modulating the transcription of genes involved in lipid metabolism. Plays a role in cholestanol metabolism in the cerebellum. Similarly to cholesterol, hydroxylates cholestanol and may facilitate sterol diffusion through the blood-brain barrier to the systemic circulation for further degradation. Also hydroxylates retinal 7-ketocholesterol, a noxious oxysterol with pro-inflammatory and pro-apoptotic effects, and may play a role in its elimination from the retinal pigment epithelium. May play a redundant role in vitamin D biosynthesis. Catalyzes 25-hydroxylation of vitamin D3 that is required for its conversion to a functionally active form.

Subcellular Location:

Mitochondrion inner membrane>Peripheral membrane protein.
Note: Post-translationally targeted to mitochondria. All three of the receptor proteins in the TOM complex, TOMM70, TOMM20 and TOMM22 are required for the translocation across the mitochondrial outer membrane. After translocation into the matrix, associates with the inner membrane as a membrane extrinsic protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the neural retina and underlying retinal pigment epithelium (at protein level). Expressed in the gray and white matter of cerebellum (at protein level).

Family&Domains:

Belongs to the cytochrome P450 family.

Research Fields

· Metabolism > Lipid metabolism > Primary bile acid biosynthesis.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Digestive system > Cholesterol metabolism.

References

1). Roles of an endogenous peptide ELABELA in ameliorating hyperuricemia by inhibiting uric acid production via CYP27A1-modulated bile acid metabolism in mice. Biochemical pharmacology, 2025 (PubMed: 41067286) [IF=5.3]

2). Antarctic krill peptide alleviated liver fibrosis via downregulating secondary bile acid activated NLRP3 signaling pathway. Food & Function, 2022 (PubMed: 35762853) [IF=5.1]

3). Sanye Tablet regulates gut microbiota and bile acid metabolism to attenuate hepatic steatosis. Journal of ethnopharmacology, 2025 (PubMed: 39971018) [IF=4.8]

4). Si-Ni-San alleviates intestinal and liver damage in ulcerative colitis mice by regulating cholesterol metabolism. Journal of ethnopharmacology, 2025 (PubMed: 39179058) [IF=4.8]

5). Specnuezhenide Ameliorates Age-Related Hepatic Lipid Accumulation via Modulating Bile Acid Homeostasis and Gut Microbiota in D-Galactose-Induced Mice. Metabolites, 2023 (PubMed: 37623903) [IF=4.1]

Application: WB    Species: Mouse    Sample:

Figure 4. Specnuezhenide (SPN) upregulates the protein expression of bile acid (BA) enzymes in D−galactose (D−gal) mice. (A) Immunohistochemistry (IHC) analysis of cytochrome P4507A1 (CYP7A1), cytochrome P45027A1 (CYP27A1), cytochrome P4507B1 (CYP7B1), and cytochrome P4508B1 (CYP8B1) in the liver (black arrows, n = 5). (B) The levels of CYP7A1, CYP27A1, CYP7B1, and CYP8B1 were analyzed using western blotting. The densitometric quantification of CYP7A1, CYP27A1, CYP7B1, and CYP8B1 is shown in the right panels (n = 3). Data are expressed as mean ± SD. ** p < 0.01 compared with the model (MOD) group.

Application: IHC    Species: Mouse    Sample:

Figure 4. Specnuezhenide (SPN) upregulates the protein expression of bile acid (BA) enzymes in D−galactose (D−gal) mice. (A) Immunohistochemistry (IHC) analysis of cytochrome P4507A1 (CYP7A1), cytochrome P45027A1 (CYP27A1), cytochrome P4507B1 (CYP7B1), and cytochrome P4508B1 (CYP8B1) in the liver (black arrows, n = 5). (B) The levels of CYP7A1, CYP27A1, CYP7B1, and CYP8B1 were analyzed using western blotting. The densitometric quantification of CYP7A1, CYP27A1, CYP7B1, and CYP8B1 is shown in the right panels (n = 3). Data are expressed as mean ± SD. ** p < 0.01 compared with the model (MOD) group.

6). Probiotics protect against hepatic steatosis in tris (2-chloroethyl) phosphate-induced metabolic disorder of mice via FXR signaling. FOOD AND CHEMICAL TOXICOLOGY, 2022 (PubMed: 36162615) [IF=3.9]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.