Cytochrome c-type Heme Lyase Antibody - #DF3540
Product: | Cytochrome c-type Heme Lyase Antibody |
Catalog: | DF3540 |
Description: | Rabbit polyclonal antibody to Cytochrome c-type Heme Lyase |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 31 KD; 31kD(Calculated). |
Uniprot: | P53701 |
RRID: | AB_2835913 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3540, RRID:AB_2835913.
Fold/Unfold
CCHL; CCHL_HUMAN; cytochrome c heme-lyase; Cytochrome c-type heme lyase; DKFZp779I1858; EC 4.4.1.17; Hccs; Holocytochrome c synthase (cytochrome c heme lyase); Holocytochrome c synthase; Holocytochrome c type synthase; Holocytochrome c-type synthase; MCOPS7; OTTHUMP00000022903; OTTHUMP00000022904; OTTHUMP00000022905; OTTMUSP00000021173; OTTMUSP00000021174; RGD1563855; RP23-37L2.1;
Immunogens
- P53701 CCHL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P53701 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
G2 | Myristoylation | Uniprot | |
T39 | Phosphorylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
Y61 | Phosphorylation | Uniprot | |
Y63 | Phosphorylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
K136 | Ubiquitination | Uniprot | |
K138 | Ubiquitination | Uniprot | |
K145 | Sumoylation | Uniprot | |
K145 | Ubiquitination | Uniprot | |
K163 | Ubiquitination | Uniprot | |
K167 | Ubiquitination | Uniprot | |
S200 | Phosphorylation | Uniprot | |
Y224 | Phosphorylation | Uniprot | |
Y228 | Phosphorylation | Uniprot | |
Y229 | Phosphorylation | Uniprot | |
T241 | Phosphorylation | Uniprot |
Research Backgrounds
Links covalently the heme group to the apoprotein of cytochrome c.
Mitochondrion inner membrane. Membrane>Lipid-anchor.
Belongs to the cytochrome c-type heme lyase family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.