ALS2CR4 Antibody - #DF3774
| Product: | ALS2CR4 Antibody |
| Catalog: | DF3774 |
| Description: | Rabbit polyclonal antibody to ALS2CR4 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 48 KD; 46kD(Calculated). |
| Uniprot: | Q96Q45 |
| RRID: | AB_2835899 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3774, RRID:AB_2835899.
Fold/Unfold
ALS2CR4 protein, N terminus truncated; Amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 4;
Immunogens
- Q96Q45 TM237_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRTDSGARLEEGHLRPPRALPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRRPSEGNEPSTKELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEPAEEAVIQKPRRKTKKTQPAELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALTVHRAFRMIGLFSHGFLAGCAVWNIVVIYVLAGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAIRNFLALDPTALASFLYFTALILSLSQQMTSDRIHLYTPSSVNGSLWEAGIEEQILQPWIVVNLVVALLVGLSWLFLSYRPGMDLSEELMFSSEVEEYPDKEKEIKASS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96Q45 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S25 | Phosphorylation | Uniprot | |
| T41 | Phosphorylation | Uniprot | |
| K42 | Ubiquitination | Uniprot | |
| T44 | Phosphorylation | Uniprot | |
| S47 | Phosphorylation | Uniprot | |
| S49 | Phosphorylation | Uniprot | |
| T56 | Phosphorylation | Uniprot | |
| S62 | Phosphorylation | Uniprot | |
| S68 | Phosphorylation | Uniprot | |
| K70 | Ubiquitination | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| S97 | Phosphorylation | Uniprot | |
| K100 | Ubiquitination | Uniprot | |
| K101 | Ubiquitination | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| S103 | Phosphorylation | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| S105 | Phosphorylation | Uniprot | |
| S106 | Phosphorylation | Uniprot | |
| K126 | Ubiquitination | Uniprot | |
| T131 | Phosphorylation | Uniprot | |
| K183 | Ubiquitination | Uniprot | |
| K209 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the transition zone in primary cilia. Required for ciliogenesis.
Membrane>Multi-pass membrane protein. Cell projection>Cilium.
Note: Localizes at the proximal region of primary cilia were observed, consistent with localization to the transition zone. Anchored to the transition zone by RPGRIP1L.
Part of the tectonic-like complex (also named B9 complex). Interacts with TMEM107.
Belongs to the TMEM237 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.