5-HT-4 Antibody | Affinity Biosciences

IF/ICC
Cites

1/4

DF3503 staining Hela cells by IF/ICC.

Figure 5 Immunofluorescence double staining images of Nestin and 5-HT4 in the Control, DM, DM + A and DM + B groups.

FIGURE 2 | Bilirubin increased 5-HT3A receptor expression and neuron activities in the spinal cord.

FIGURE 2 Bilirubin increased 5-HT3A receptor expression and neuron activities in the spinal cord.

Product:	5-HT-4 Antibody
Catalog:	DF3503
Description:	Rabbit polyclonal antibody to 5-HT-4
Application:	WB IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Bovine, Sheep, Rabbit
Mol.Wt.:	43 KD; 44kD(Calculated).
Uniprot:	Q13639
RRID:	AB_2835865

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Bovine(82%), Sheep(82%), Rabbit(91%)

Clonality:

Polyclonal

Specificity:

5-HT-4 Antibody detects endogenous levels of total 5-HT-4.

RRID:

AB_2835865
Cite Format: Affinity Biosciences Cat# DF3503, RRID:AB_2835865.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

5 HT 4; 5 HT4; 5 HT4R; 5 hydroxytryptamine (serotonin) receptor 4, G protein coupled; 5 hydroxytryptamine 4 receptor; 5 hydroxytryptamine receptor 4; 5 hydroxytryptamine serotonin receptor 4; 5 hydroxytryptamine4 receptor; 5-HT-4; 5-ht4; 5-HT4R; 5H4; 5HT 4; 5HT4; 5ht4 receptor; 5HT4R; Cardiac 5 HT4 receptor; HTR 4; HTR4; serotonin 4 receptor; Serotonin 5 HT4 receptor; serotonin 5-ht-4 receptor; serotonin 5-ht-4a; Serotonin receptor 4;

Immunogens

Immunogen:

Uniprot:

Q13639(5HT4R_HUMAN) >>Visit HPA database.

Gene(ID):

HTR4(3360)

Expression:

Q13639 5HT4R_HUMAN:

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.

Sequence:

Q13639 5HT4R_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Rabbit

Bovine

Sheep

Pig

Horse

Dog

Xenopus

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q13639 As Substrate

Q13639

Site	PTM Type	Enzyme	Source
S354	Phosphorylation		Uniprot
T355	Phosphorylation		Uniprot

Research Backgrounds

Q13639_5HT4R_HUMAN

Function:

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Endosome.
Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli.

Tissue Specificity:

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.

Subunit Structure:

Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with PATJ, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR (By similarity). Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin).

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Organismal Systems > Nervous system > Serotonergic synapse.

References

1). Bilirubin Induces Pain Desensitization in Cholestasis by Activating 5-Hydroxytryptamine 3A Receptor in Spinal Cord. Frontiers in Cell and Developmental Biology, 2021 (PubMed: 33869168) [IF=5.5]

Application: WB Species: rat Sample: spinal cord

FIGURE 2 | Bilirubin increased 5-HT3A receptor expression and neuron activities in the spinal cord. (C) Intrathecal administration of bilirubin increased 5-HT3A receptor expression without changing other subtypes.

Application: WB Species: Rat Sample: spinal cords

FIGURE 2 Bilirubin increased 5-HT3A receptor expression and neuron activities in the spinal cord. (A) 5-HT3A receptor expression increased gradually in spinal cord enlargement of BDL rats, whereas expression of 5-HT3B, 5-HT3C, 5-HT3D, and 5-HT3E receptors did not change significantly. (B) The quantitative analysis of 5-HT3A receptor expression in BDL rats. (C) Intrathecal administration of bilirubin increased 5-HT3A receptor expression without changing other subtypes. (D) The quantitative analysis of 5-HT3A receptor expression after intrathecal administration of bilirubin in normal rats. (E) SDHNs cultured with bilirubin showed increased 5-HT3A receptor expression without changing other subtypes. (F) The quantitative analysis of 5-HT3A receptor expression in SDHNs. (G) Immunofluorescence showed that 5-HT3A receptor expression increased in laminas I and II in the spinal cords of BDL rats. The increased C-Fos protein (marker of neuron activity) expression indicated that neuron activities were also enhanced in the spinal cords of BDL rats. *P < 0.05.

2). Prucalopride might improve intestinal motility by promoting the regeneration of the enteric nervous system in diabetic rats. International Journal of Molecular Medicine, 2022 (PubMed: 35543167) [IF=5.4]

Application: IF/ICC Species: Rat Sample:

Figure 5 Immunofluorescence double staining images of Nestin and 5-HT4 in the Control, DM, DM + A and DM + B groups. DAPI-stained nuclei appeared blue. Nestin and 5-HT4 are indicated by red fluorescence and green fluorescence, respectively. A rat model of DM was established using an intraperitoneal injection of streptozotocin. The rats in the Control group were given an equal volume of citric acid solvent. Magnification, ×100. *P<0.05 vs. Control; #P<0.05 vs. DM. DM, diabetes mellitus model; DM + A, diabetic rats treated with 5 µg/kg prucalopride; DM + B, diabetic rats treated with 10 µg/kg prucalopride; 5-HT4, 5-hydroxytryptamine 4.

3). Qi Lang formula relieves constipation via targeting SCF/c-kit signaling pathway: An integrated study of network pharmacology and experimental validation. Heliyon, 2024 (PubMed: 38841509) [IF=4.0]

4). scRNA-Seq and Network Pharmacology Analysis Reveal SCF/C-kit as the Targeting Mechanism of Qi Lang Formula Relieving Constipation. , 2024

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

5-HT-4 Antibody - #DF3503