Product: 5HT2C Receptor Antibody
Catalog: DF3501
Description: Rabbit polyclonal antibody to 5HT2C Receptor
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 55 KD(Observed); 52kD(Calculated).
Uniprot: P28335
RRID: AB_2835863

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(91%), Horse(91%), Sheep(91%), Rabbit(91%), Dog(100%)
Clonality:
Polyclonal
Specificity:
5HT2C Receptor Antibody detects endogenous levels of total 5HT2C Receptor.
RRID:
AB_2835863
Cite Format: Affinity Biosciences Cat# DF3501, RRID:AB_2835863.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

5 Hydroxytryptamine 2C receptor; 5-HT-1C; 5-ht-1c receptor; 5-HT-2C; 5-HT1C; 5-HT2C; 5-HTR2C; 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled; 5-hydroxytryptamine receptor 1C; 5-hydroxytryptamine receptor 2C; 5HT1C; 5HT2C; 5HT2C_HUMAN; 5HTR2C; 5Hydroxytryptamine 2C receptor; Htr1c; HTR2C; serotonin 1c receptor; serotonin 2c receptor; Serotonin 5-HT-2C receptor; Serotonin receptor 2C;

Immunogens

Immunogen:

A synthesized peptide derived from human 5HT2C Receptor, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P28335 5HT2C_HUMAN:

Detected in brain.

Sequence:
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
100
Pig
91
Horse
91
Sheep
91
Rabbit
91
Xenopus
64
Chicken
64
Bovine
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelacortin neurons and the release of CRH that then regulates the release of corticosterone. Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress. Plays a role in insulin sensitivity and glucose homeostasis.

PTMs:

N-glycosylated.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in brain.

Family&Domains:

The PDZ domain-binding motif is involved in the interaction with MPDZ.

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Organismal Systems > Nervous system > Serotonergic synapse.

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels.   (View pathway)

References

1). Sexual dimorphism of lung immune-regulatory units imprint biased pulmonary fibrosis. Cellular & molecular immunology, 2025 (PubMed: 40360692) [IF=21.8]

2). Agomelatine rescues lipopolysaccharide-induced neural injury and depression-like behaviors via suppression of the Gαi-2-PKA-ASK1 signaling pathway. Journal of Neuroinflammation, 2022 (PubMed: 35610704) [IF=9.3]

Application: IF/ICC    Species: Rat    Sample:

Fig. 2 Agomelatine appears to exert antidepressant effects through regulation of downstream pathways involving interactions of the 5-HT2C reporter and Gαi-2. A Representative images of the 5-HT2C receptor (red). Nuclei (blue) are stained with DAPI. Neurons (green) are stained with Anti-NeuN. Scale bar is 5 μm (N = 6 per group). B Representative images of laser scanning confocal microscopy of the 5-HT2C receptor (red) and Gαi-2 (green) in the hippocampal DG region. C CO-IP analysis of endogenous interactions between the 5-HT2C receptor and Gαi-2 in the DG region. D ELISA analysis of cAMP in the DG region of LPS-treated rats receiving a pretreatment of agomelatine. E Western blot assays of protein expression levels of the 5-HT2C receptor, Gαi-2, P-PKA and P-ASK1within the DG region (N = 6 per group). *P 

Application: WB    Species: Rat    Sample:

Fig. 2 Agomelatine appears to exert antidepressant effects through regulation of downstream pathways involving interactions of the 5-HT2C reporter and Gαi-2. A Representative images of the 5-HT2C receptor (red). Nuclei (blue) are stained with DAPI. Neurons (green) are stained with Anti-NeuN. Scale bar is 5 μm (N = 6 per group). B Representative images of laser scanning confocal microscopy of the 5-HT2C receptor (red) and Gαi-2 (green) in the hippocampal DG region. C CO-IP analysis of endogenous interactions between the 5-HT2C receptor and Gαi-2 in the DG region. D ELISA analysis of cAMP in the DG region of LPS-treated rats receiving a pretreatment of agomelatine. E Western blot assays of protein expression levels of the 5-HT2C receptor, Gαi-2, P-PKA and P-ASK1within the DG region (N = 6 per group). *P 

3). The enhancing effect of 5-HT on phasic contractions of human isolated distal ureter and the mechanisms mediating these effects. European journal of pharmacology, 2023 (PubMed: 37059373) [IF=4.2]

Application: WB    Species: human    Sample:

Fig. 9. 5-HT2A/2C receptor protein expression in human distal ureter. (A) Western blot experiments show 5-HT2A (left) and 5-HT2C (right) expression in ureter tissue from the mucosal or intact layer. Bands for 5-HT2A at the expected weight of 55 kDa and bands for 5-HT2C at expected weight of 53 kDa. GAPDH was used as the control. (B) Immunofluorescence labeling showed that 5-HT2A (left) or 5-HT2C (right) receptors are expressed on nerve terminals, interstitial cells, and on the urothelium of human ureter.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.