14-3-3 eta Antibody - #DF3492
Product: | 14-3-3 eta Antibody |
Catalog: | DF3492 |
Description: | Rabbit polyclonal antibody to 14-3-3 eta |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 42 KD; 28kD(Calculated). |
Uniprot: | Q04917 |
RRID: | AB_2835854 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3492, RRID:AB_2835854.
Fold/Unfold
14 3 3 protein eta; 14-3-3 eta; 14-3-3 protein eta; 1433F_HUMAN; Brain protein 14-3-3, eta isoform; HGNC:12853; Protein AS1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, eta isoform; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta; Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide; YWHA 1; YWHA1; Ywhah;
Immunogens
Expressed mainly in the brain and present in other tissues albeit at lower levels.
- Q04917 1433F_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q04917 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y20 | Phosphorylation | Uniprot | |
S25 | Phosphorylation | Uniprot | |
S38 | Phosphorylation | Uniprot | |
R42 | Methylation | Uniprot | |
S46 | Phosphorylation | Uniprot | |
Y49 | Phosphorylation | Uniprot | |
K50 | Acetylation | Uniprot | |
K50 | Methylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
S58 | Phosphorylation | Uniprot | |
S59 | Phosphorylation | Q05655 (PRKCD) | Uniprot |
S65 | Phosphorylation | Uniprot | |
K69 | Acetylation | Uniprot | |
K69 | Ubiquitination | Uniprot | |
K77 | Ubiquitination | Uniprot | |
K91 | Ubiquitination | Uniprot | |
K106 | Ubiquitination | Uniprot | |
K110 | Ubiquitination | Uniprot | |
S119 | Phosphorylation | Uniprot | |
K120 | Acetylation | Uniprot | |
K120 | Ubiquitination | Uniprot | |
Y123 | Phosphorylation | Uniprot | |
K125 | Acetylation | Uniprot | |
K125 | Ubiquitination | Uniprot | |
K127 | Ubiquitination | Uniprot | |
Y130 | Phosphorylation | Uniprot | |
Y131 | Phosphorylation | Uniprot | |
S139 | Phosphorylation | Uniprot | |
K142 | Acetylation | Uniprot | |
K142 | Ubiquitination | Uniprot | |
K143 | Ubiquitination | Uniprot | |
S145 | Phosphorylation | Uniprot | |
Y154 | Phosphorylation | Uniprot | |
K155 | Ubiquitination | Uniprot | |
T168 | Phosphorylation | Uniprot | |
S215 | Phosphorylation | Uniprot | |
Y216 | Phosphorylation | Uniprot | |
S219 | Phosphorylation | Uniprot | |
T220 | Phosphorylation | Uniprot |
Research Backgrounds
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Phosphorylated on Ser-59 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion.
Expressed mainly in the brain and present in other tissues albeit at lower levels.
Homodimer (By similarity). Interacts with many nuclear hormone receptors and cofactors including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP and THRA. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Interacts with ARHGEF28 and CDK16 (By similarity). Weakly interacts with CDKN1B. Interacts with GAB2. Interacts with KCNK18 in a phosphorylation-dependent manner. Interacts with SAMSN1 (By similarity). Interacts with the 'Ser-241' phosphorylated form of PDPK1. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with SLITRK1.
Belongs to the 14-3-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.