14-3-3 epsilon Antibody - #DF3491
| Product: | 14-3-3 epsilon Antibody |
| Catalog: | DF3491 |
| Description: | Rabbit polyclonal antibody to 14-3-3 epsilon |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 29 KD; 29kD(Calculated). |
| Uniprot: | P62258 |
| RRID: | AB_2835853 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3491, RRID:AB_2835853.
Fold/Unfold
14 3 3 E; 14 3 3 epsilon; 14 3 3E; 14-3-3 protein epsilon; 14-3-3E; 1433E_HUMAN; Epididymis luminal protein 2; FLJ45465; FLJ53559; HEL2; KCIP 1; KCIP1; MDCR; MDS; Mitochondrial import stimulation factor L subunit; Protein kinase C inhibitor protein1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, epsilon polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein epsilon polypeptide; YWHAE;
Immunogens
- P62258 1433E_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62258 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| R4 | Methylation | Uniprot | |
| K12 | Acetylation | Uniprot | |
| K12 | Ubiquitination | Uniprot | |
| K28 | Acetylation | Uniprot | |
| K28 | Ubiquitination | Uniprot | |
| K29 | Ubiquitination | Uniprot | |
| T38 | Phosphorylation | Uniprot | |
| S46 | Phosphorylation | Uniprot | |
| Y49 | Phosphorylation | Uniprot | |
| K50 | Acetylation | Uniprot | |
| K50 | Ubiquitination | Uniprot | |
| S59 | Phosphorylation | Uniprot | |
| S64 | Phosphorylation | Uniprot | |
| S65 | Phosphorylation | Uniprot | |
| K69 | Acetylation | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| K78 | Acetylation | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| T91 | Phosphorylation | Uniprot | |
| C97 | S-Nitrosylation | Uniprot | |
| C98 | S-Nitrosylation | Uniprot | |
| K106 | Acetylation | Uniprot | |
| K106 | Ubiquitination | Uniprot | |
| T114 | Phosphorylation | Uniprot | |
| S117 | Phosphorylation | Uniprot | |
| K118 | Acetylation | Uniprot | |
| K118 | Ubiquitination | Uniprot | |
| Y122 | Phosphorylation | Uniprot | |
| K123 | Acetylation | Uniprot | |
| K123 | Ubiquitination | Uniprot | |
| K125 | Ubiquitination | Uniprot | |
| R130 | Methylation | Uniprot | |
| Y131 | Phosphorylation | Uniprot | |
| K142 | Acetylation | Uniprot | |
| K142 | Ubiquitination | Uniprot | |
| S148 | Phosphorylation | Uniprot | |
| K153 | Methylation | Uniprot | |
| K153 | Ubiquitination | Uniprot | |
| Y181 | Phosphorylation | Uniprot | |
| K196 | Ubiquitination | Uniprot | |
| T208 | Phosphorylation | Q9NYY3 (PLK2) , Q9H4B4 (PLK3) | Uniprot |
| S210 | Phosphorylation | Uniprot | |
| S213 | Phosphorylation | Uniprot | |
| Y214 | Phosphorylation | Uniprot | |
| S217 | Phosphorylation | Uniprot | |
| T218 | Phosphorylation | Uniprot | |
| T232 | Phosphorylation | Uniprot | |
| S233 | Phosphorylation | Uniprot | |
| K244 | Ubiquitination | Uniprot |
Research Backgrounds
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner (By similarity). Positively regulates phosphorylated protein HSF1 nuclear export to the cytoplasm.
Nucleus. Cytoplasm. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Homodimer. Heterodimerizes with YWHAZ. Interacts with PKA-phosphorylated AANAT. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Interacts with ARHGEF28 (By similarity). Interacts with BEX3 (By similarity). Weakly interacts with CDKN1B. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with DENND1A. Interacts with GAB2. Interacts with phosphorylated GRB10. Interacts with KSR1. Interacts with NDEL1 (By similarity). Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with the phosphorylated (by AKT1) form of SRPK2. Interacts with TIAM2. Interacts with the 'Ser-1134' and 'Ser-1161' phosphorylated form of SOS1 (By similarity). Interacts with ZFP36 (via phosphorylated form) (By similarity). Interacts with SLITRK1. Interacts with HSF1 (via phosphorylated form); this interaction promotes HSF1 sequestration in the cytoplasm in a ERK-dependent manner. Interacts with RIPOR2 isoform 2. Interacts with KLHL22; required for the nuclear localization of KLHL22 upon amino acid starvation. Interacts with CRTC1. Interacts with CRTC2 (probably when phosphorylated at 'Ser-171'). Interacts with CRTC3 (probably when phosphorylated at 'Ser-162' and/or 'Ser-273'). Interacts with ATP2B1; this interaction inhibits calcium-transporting ATPase activity.
(Microbial infection) Interacts with HCV core protein.
Belongs to the 14-3-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.