CNOT7 Antibody - #DF3469
| Product: | CNOT7 Antibody |
| Catalog: | DF3469 |
| Description: | Rabbit polyclonal antibody to CNOT7 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 36 KD; 33kD(Calculated). |
| Uniprot: | Q9UIV1 |
| RRID: | AB_2835833 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3469, RRID:AB_2835833.
Fold/Unfold
BTG1 binding factor 1; BTG1-binding factor 1; CAF 1; CAF-1; CAF1; Carbon catabolite repressor protein (CCR4) associative factor 1; CCR4 associated factor 1; CCR4 NOT transcription complex subunit 7; CCR4-associated factor 1; CCR4-NOT transcription complex subunit 7; CNOT 7; Cnot7; CNOT7_HUMAN; hCAF 1; hCAF1;
Immunogens
- Q9UIV1 CNOT7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UIV1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K33 | Ubiquitination | Uniprot | |
| Y193 | Phosphorylation | Uniprot | |
| K200 | Acetylation | Uniprot | |
| K200 | Ubiquitination | Uniprot | |
| K206 | Acetylation | Uniprot | |
| K206 | Ubiquitination | Uniprot | |
| S231 | Phosphorylation | Uniprot | |
| T234 | Phosphorylation | Uniprot | |
| K240 | Ubiquitination | Uniprot | |
| Y260 | Phosphorylation | Uniprot |
Research Backgrounds
Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.
Nucleus. Cytoplasm>P-body.
Note: NANOS2 promotes its localization to P-body.
Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits; the complex contains two deadenylase subunits, CNOT6 or CNOT6L, and CNOT7 or CNOT8. In the complex, interacts directly with CNOT1. Interacts with AGO2 (By similarity). Interacts with TOB1; recruited by TOB1 to a ternary complex with CPEB3 which is required for mRNA deadenylation and decay. Interacts with BTG1 (By similarity). Interacts with BTG2. Interacts with NANOS2 (By similarity). Interacts with ZFP36, ZFP36L1 and ZFP36L2; these interactions are inhibited in response to phorbol 12-myristate 13-acetate (PMA) treatment in a p38 MAPK-dependent manner. Interacts with TARDBP.
Belongs to the CAF1 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.