MORF4L1 Antibody - #DF3463
Product: | MORF4L1 Antibody |
Catalog: | DF3463 |
Description: | Rabbit polyclonal antibody to MORF4L1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 41 KD; 41kD(Calculated). |
Uniprot: | Q9UBU8 |
RRID: | AB_2835827 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3463, RRID:AB_2835827.
Fold/Unfold
CG6363; Eaf3; Esa1p associated factor 3 homolog; FWP006; HsT17725; MEAF3; MO4L1_HUMAN; MORF related gene on chromosome 15; MORF-related gene 15 protein; Morf4l1; MORFRG15; Mortality factor 4 like 1; Mortality factor 4 like protein 1; Mortality factor 4-like protein 1; MRG15; Protein MSL3-1; S863-6; Transcription factor-like protein MRG15;
Immunogens
- Q9UBU8 MO4L1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
PTMs - Q9UBU8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K10 | Ubiquitination | Uniprot | |
K29 | Ubiquitination | Uniprot | |
K32 | Ubiquitination | Uniprot | |
K38 | Ubiquitination | Uniprot | |
K103 | Ubiquitination | Uniprot | |
K111 | Ubiquitination | Uniprot | |
K117 | Ubiquitination | Uniprot | |
Y123 | Phosphorylation | Uniprot | |
K127 | Ubiquitination | Uniprot | |
K136 | Ubiquitination | Uniprot | |
K143 | Acetylation | Uniprot | |
K143 | Ubiquitination | Uniprot | |
K148 | Ubiquitination | Uniprot | |
T156 | Phosphorylation | Uniprot | |
T168 | Phosphorylation | Uniprot | |
K174 | Ubiquitination | Uniprot | |
K175 | Ubiquitination | Uniprot | |
K196 | Ubiquitination | Uniprot | |
K198 | Ubiquitination | Uniprot | |
K204 | Ubiquitination | Uniprot | |
K218 | Ubiquitination | Uniprot | |
K226 | Ubiquitination | Uniprot | |
K227 | Ubiquitination | Uniprot | |
Y236 | Phosphorylation | Uniprot | |
Y239 | Phosphorylation | Uniprot | |
K240 | Ubiquitination | Uniprot | |
K241 | Ubiquitination | Uniprot | |
K249 | Ubiquitination | Uniprot | |
K339 | Ubiquitination | Uniprot | |
S348 | Phosphorylation | Uniprot |
Research Backgrounds
Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones. Required for homologous recombination repair (HRR) and resistance to mitomycin C (MMC). Involved in the localization of PALB2, BRCA2 and RAD51, but not BRCA1, to DNA-damage foci.
Nucleus.
Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. The NuA4 complex interacts with MYC and the adenovirus E1A protein. MORF4L1 may also participate in the formation of NuA4 related complexes which lack the KAT5/TIP60 catalytic subunit, but which include the SWI/SNF related protein SRCAP. Component of the mSin3A histone deacetylase complex, which includes SIN3A, HDAC2, ARID4B, MORF4L1, RBBP4/RbAp48, and RBBP7/RbAp46. Interacts with RB1 and KAT8. May also interact with PHF12 and one or more as yet undefined members of the TLE (transducin-like enhancer of split) family of transcriptional repressors. Interacts with the N-terminus of MRFAP1. Found in a complex composed of MORF4L1, MRFAP1 and RB1. Interacts with the entire BRCA complex, which contains BRCA1, PALB2, BRCA2 and RAD51. Interacts with PALB2. Forms a complex with MSL1 and NUPR1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.