DUSP19 Antibody - #DF3371
| Product: | DUSP19 Antibody |
| Catalog: | DF3371 |
| Description: | Rabbit polyclonal antibody to DUSP19 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Bovine, Sheep, Rabbit, Dog |
| Mol.Wt.: | 28 KD; 24kD(Calculated). |
| Uniprot: | Q8WTR2 |
| RRID: | AB_2835753 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3371, RRID:AB_2835753.
Fold/Unfold
Dual specificity phosphatase 19; Dual specificity phosphatase TS DSP1; Dual specificity phosphatase TS-DSP1; Dual specificity protein phosphatase 19; DUS19_HUMAN; DUSP 17; DUSP 19; DUSP17; Dusp19; LMW DSP3; LMW-DSP3; LMWDSP 3; LMWDSP3; Low molecular weight dual specificity phosphatase 3; MGC138210; Protein phosphatase SKRP1; SAPK pathway regulating phosphatase 1; SAPK pathway-regulating phosphatase 1; SKRP 1; SKRP1; Stress activated protein kinase pathway regulating phosphatase 1; Stress-activated protein kinase pathway-regulating phosphatase 1; TS DSP1;
Immunogens
Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
- Q8WTR2 DUS19_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8WTR2 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| Y2 | Phosphorylation | Uniprot | |
| T24 | Phosphorylation | Uniprot | |
| T27 | Phosphorylation | Uniprot |
Research Backgrounds
Has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.