NT5C3 Antibody - #DF3430
Product: | NT5C3 Antibody |
Catalog: | DF3430 |
Description: | Rabbit polyclonal antibody to NT5C3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Horse, Sheep |
Mol.Wt.: | 38 KD; 38kD(Calculated). |
Uniprot: | Q9H0P0 |
RRID: | AB_2835730 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3430, RRID:AB_2835730.
Fold/Unfold
5NT3A_HUMAN; cN III; cN-III; cNIII; Cytosolic 5' nucleotidase 3; Cytosolic 5' nucleotidase III; Cytosolic 5''-nucleotidase 3; Cytosolic 5''-nucleotidase 3A; Cytosolic 5''-nucleotidase III; Nt5c3a; p36; P5''N-1; P5'N 1; P5'N1; P5N 1; P5N-1; P5N1; PN I; PN-I; PNI; PSN1; Pyrimidine 5' nucleotidase 1; Pyrimidine 5''-nucleotidase 1; UMPH; UMPH1; Uridine 5' monophosphate hydrolase 1; Uridine 5''-monophosphate hydrolase 1;
Immunogens
Isoforms 1, 3 and 4 are expressed in reticulocytes. Isoform 4 is hardly detectable in bone marrow and fetal liver.
- Q9H0P0 5NT3A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H0P0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K47 | Ubiquitination | Uniprot | |
K57 | Ubiquitination | Uniprot | |
K77 | Ubiquitination | Uniprot | |
K128 | Ubiquitination | Uniprot | |
K130 | Ubiquitination | Uniprot | |
K167 | Ubiquitination | Uniprot | |
K225 | Ubiquitination | Uniprot | |
S228 | Phosphorylation | Uniprot | |
T236 | Phosphorylation | Uniprot | |
K243 | Ubiquitination | Uniprot | |
K252 | Ubiquitination | Uniprot | |
T260 | Phosphorylation | Uniprot | |
K267 | Ubiquitination | Uniprot | |
S278 | Phosphorylation | Uniprot | |
K296 | Ubiquitination | Uniprot | |
R303 | Methylation | Uniprot | |
K334 | Ubiquitination | Uniprot |
Research Backgrounds
Nucleotidase which shows specific activity towards cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m(7)GMP). CMP seems to be the preferred substrate.
Cytoplasm.
Endoplasmic reticulum.
Isoforms 1, 3 and 4 are expressed in reticulocytes. Isoform 4 is hardly detectable in bone marrow and fetal liver.
Monomer.
Belongs to the pyrimidine 5'-nucleotidase family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.