YTHDF1 Antibody - #DF3422
![](/images/pubmed.gif)
Product: | YTHDF1 Antibody |
Catalog: | DF3422 |
Description: | Rabbit polyclonal antibody to YTHDF1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Sheep, Chicken, Xenopus |
Mol.Wt.: | 61 KD; 61kD(Calculated). |
Uniprot: | Q9BYJ9 |
RRID: | AB_2835722 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3422, RRID:AB_2835722.
Fold/Unfold
C20orf21; DACA 1; DACA-1; Dermatomyositis associated with cancer putative autoantigen 1; YTH domain family 1; YTH domain family member 1; YTH domain family protein 1; YTHD1; YTHD1_HUMAN; Ythdf1;
Immunogens
- Q9BYJ9 YTHD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BYJ9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
S5 | Phosphorylation | Uniprot | |
K12 | Ubiquitination | Uniprot | |
Y116 | Phosphorylation | Uniprot | |
S182 | Phosphorylation | Uniprot | |
K191 | Ubiquitination | Uniprot | |
S196 | O-Glycosylation | Uniprot | |
S198 | Phosphorylation | Uniprot | |
K240 | Ubiquitination | Uniprot | |
S252 | Phosphorylation | Uniprot | |
K266 | Ubiquitination | Uniprot | |
T273 | Phosphorylation | Uniprot | |
S291 | Phosphorylation | Uniprot | |
R327 | Methylation | Uniprot | |
S346 | Phosphorylation | Uniprot | |
S348 | Phosphorylation | Uniprot | |
S350 | Phosphorylation | Uniprot | |
S364 | Phosphorylation | Uniprot | |
K370 | Ubiquitination | Uniprot | |
K372 | Ubiquitination | Uniprot | |
K380 | Ubiquitination | Uniprot | |
K387 | Ubiquitination | Uniprot | |
K395 | Ubiquitination | Uniprot | |
S398 | Phosphorylation | Uniprot | |
S409 | Phosphorylation | Uniprot | |
S413 | Phosphorylation | Uniprot | |
K419 | Ubiquitination | Uniprot | |
K469 | Ubiquitination | Uniprot | |
K473 | Ubiquitination | Uniprot | |
R493 | Methylation | Uniprot | |
K500 | Ubiquitination | Uniprot | |
K515 | Ubiquitination | Uniprot | |
K527 | Ubiquitination | Uniprot | |
K541 | Ubiquitination | Uniprot |
Research Backgrounds
Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. Acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. Required to facilitate learning and memory formation in the hippocampus by enhancing protein synthesis upon neuronal stimulation: in response to neuronal stimulation, binds to m6A-containing neuronal mRNAs, promoting their translation, thereby contributing to learning and memory (By similarity). Acts as a regulator of axon guidance by binding to m6A-containing ROBO3 transcripts, thereby promoting their translation (By similarity). Acts as a negative regulator of antigen cross-presentation in myeloid dendritic cells (By similarity). Acts by binding and promoting translation of m6A-containing transcripts encoding proteins involved in lysosomal degradation and phagosome maturation, leading to increased antigen degradation in myeloid dendritic cells (By similarity). In the context of tumorigenesis, negative regulation of antigen cross-presentation limits the anti-tumor response by reducing efficiency of tumor-antigen cross-presentation (By similarity).
Cytoplasm.
Interacts with ribosomes. Interacts with eIF3 (EIF3A or EIF3B). Interacts with YTHDF3.
References
Application: WB Species: Mice Sample: Liver Fibrosis
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.