TNFAIP8L2 Antibody - #DF3326
Product: | TNFAIP8L2 Antibody |
Catalog: | DF3326 |
Description: | Rabbit polyclonal antibody to TNFAIP8L2 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 20 KD; 21kD(Calculated). |
Uniprot: | Q6P589 |
RRID: | AB_2835693 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3326, RRID:AB_2835693.
Fold/Unfold
AW610835; FLJ23467; Inflammation factor 20; Inflammation factor protein 20; TIPE2; TNF alpha-induced protein 8-like protein 2; TNFAIP8-like protein 2; TNFAIP8L2; TP8L2_HUMAN; Tumor necrosis factor alpha induced protein 8 like 2; Tumor necrosis factor alpha-induced protein 8-like protein 2;
Immunogens
- Q6P589 TP8L2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q6P589 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S3 | Phosphorylation | Uniprot | |
T88 | Phosphorylation | Uniprot | |
T136 | Phosphorylation | Uniprot |
Research Backgrounds
Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis (By similarity).
May interact with CASP8; however, such result is unclear sincecould not reproduce the interaction with CASP8.
The central region was initially thought to constitute a DED (death effector) domain. However, 3D-structure data reveal a previously uncharacterized fold that is different from the predicted fold of a DED (death effector) domain. It consists of a large, hydrophobic central cavity that is poised for cofactor binding.
Belongs to the TNFAIP8 family. TNFAIP8L2 subfamily.
References
Application: WB Species: mice Sample: RAW 264.7 cells
Application: WB Species: rat Sample: lung
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.