FAKD1 Antibody - #DF3315
| Product: | FAKD1 Antibody |
| Catalog: | DF3315 |
| Description: | Rabbit polyclonal antibody to FAKD1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
| Mol.Wt.: | 97 KD; 97kD(Calculated). |
| Uniprot: | Q53R41 |
| RRID: | AB_2835683 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3315, RRID:AB_2835683.
Fold/Unfold
FAKD1_HUMAN; FAST kinase domain containing protein 1; FAST kinase domain-containing protein 1; FAST kinase domains 1; FASTKD1; FLJ21901; KIAA1800; OTTHUMP00000207008; OTTHUMP00000207010;
Immunogens
Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart.
- Q53R41 FAKD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKKTPVFLESLVTNMLRLRAICPFSWRVFQFRPISCEPLIIQMNKCTDEEQMFGFIERNKAILSEKQVGCAFDMLWKLQKQKTSLLKNAEYVRDHPQFLTLHNLATNKFKLMNDDTLVNVLYVTQQFAGEAHDPLVEALVTEAWRRLERFDIKLLSEFSSCLADQHLYFSPLMGKIADIVHRNLETTQDLSSLSVLMVNISSLISRHFQQQLVNKTELLFDTIDSSEVNVAKSIAKFLRNVRYRYQPLLERCNNVFLSNVDHLDLDSISKILSVYKFLQFNSFEFIIMAKKKLTEMIPLCNHPASFVKLFVALGPIAGPEEKKQLKSTMLLMSEDLTGEQALAVLGAMGDMESRNSCLIKRVTSVLHKHLDGYKPLELLKITQELTFLHFQRKEFFAKLRELLLSYLKNSFIPTEVSVLVRAISLLPSPHLDEVGISRIEAVLPQCDLNNLSSFATSVLRWIQHDHMYLDNMTAKQLKLLQKLDHYGRQRLQHSNSLDLLRKELKSLKGNTFPESLLEEMIATLQHFMDDINYINVGEIASFISSTDYLSTLLLDRIASVAVQQIEKIHPFTIPAIIRPFSVLNYDPPQRDEFLGTCVQHLNSYLGILDPFILVFLGFSLATLEYFPEDLLKAIFNIKFLARLDSQLEILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKGIGGMDGTQQQIFKMLAEVLGGINCVKASVLTPYYHKVDFECILDKRKKPLPYGSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRECIFGEVKSCL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q53R41 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K60 | Ubiquitination | Uniprot | |
| T83 | Phosphorylation | Uniprot | |
| K87 | Ubiquitination | Uniprot | |
| Y122 | Phosphorylation | Uniprot | |
| T124 | Phosphorylation | Uniprot | |
| Y168 | Phosphorylation | Uniprot | |
| S170 | Phosphorylation | Uniprot | |
| S194 | Phosphorylation | Uniprot | |
| S202 | Phosphorylation | Uniprot | |
| S305 | Phosphorylation | Uniprot | |
| K360 | Acetylation | Uniprot | |
| K374 | Ubiquitination | Uniprot | |
| S405 | Phosphorylation | Uniprot | |
| Y406 | Phosphorylation | Uniprot | |
| K478 | Ubiquitination | Uniprot | |
| K482 | Ubiquitination | Uniprot | |
| Y486 | Phosphorylation | Uniprot | |
| S496 | Phosphorylation | Uniprot | |
| T546 | Phosphorylation | Uniprot | |
| T551 | Phosphorylation | Uniprot | |
| K691 | Ubiquitination | Uniprot | |
| Y726 | Phosphorylation | Uniprot | |
| K728 | Ubiquitination | Uniprot | |
| K737 | Ubiquitination | Uniprot | |
| K785 | Ubiquitination | Uniprot | |
| Y810 | Phosphorylation | Uniprot | |
| K844 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in the down-regulation of mitochondrial MT-ND3 mRNA levels which leads to decreased respiratory complex I abundance and activity.
Mitochondrion.
Note: Preferentially localizes to mitochondrial RNA granules, platforms for post-transcriptional RNA modification and ribosome assembly (PubMed:28335001).
Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart.
The RAP domain is essential to regulate MT-ND3 mRNA levels.
Belongs to the FAST kinase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.