SEC22B Recombinant Rabbit mAb - #BF4455

(1)   Copy Info
Product: SEC22B Recombinant Rabbit mAb
Catalog: BF4455
Description: Rabbit monoclonal antibody to SEC22B
Application: WB IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25 kDa(Observed); 25kD(Calculated).
Uniprot: O75396

View similar products>>

Out of stock
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23905]
Specificity:
SEC22B Recombinant Rabbit mAb detects endogenous levels of SEC22B.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ERS 24; ERS24; SEC22 vesicle trafficking protein homolog B; SEC22 vesicle trafficking protein like 1; SEC22B; SEC22L 1; Vesicle trafficking protein SEC22b;

Immunogens

Immunogen:

A synthetic peptide from human SEC22B

Uniprot:

O75396(SC22B_HUMAN) >>Visit HPA database.

Gene(ID):
SEC22B(9554)
Description:
The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.
Sequence:
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCDLVLCEAAFPKTLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSCARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMHSTYAKLAAVAVFFIMLIVYVRFWWL

Research Backgrounds

Function:

SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER.

Subcellular Location:

Endoplasmic reticulum membrane>Single-pass type IV membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus>cis-Golgi network membrane. Golgi apparatus>trans-Golgi network membrane. Melanosome.
Note: Concentrated most in the intermediate compartment/cis-Golgi network and the cis-Golgi cisternae 1 and 2. Greatly reduced in concentration at the trans end of the Golgi apparatus (By similarity). Identified by mass spectrometry in melanosome fractions from stage I to stage IV (PubMed:17081065).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the synaptobrevin family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.