MEF2B Antibody - #DF3236
Product: | MEF2B Antibody |
Catalog: | DF3236 |
Description: | Rabbit polyclonal antibody to MEF2B |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 38 KD; 39kD(Calculated). |
Uniprot: | Q02080 |
RRID: | AB_2835616 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3236, RRID:AB_2835616.
Fold/Unfold
MADS box transcription enhancer factor 2; MDS1 EVI1; Mef2b; MEF2B_HUMAN; Myocyte enhancer factor 2B; Myocyte specific enhancer factor 2B; Myocyte-specific enhancer factor 2B; PRDM3; RSRFR2; Serum response factor like protein 2; Serum response factor-like protein 2; XMEF2;
Immunogens
- Q02080 MEF2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNPCSTATPGPPLGSFPFLPGGPPVGAEAWARRVPQPAAPPRRPPQSASSLSASLRPPGAPATFLRPSPIPCSSPGPWQSLCGLGPPCAGCPWPTAGPGRRSPGGTSPERSPGTARARGDPTSLQASSEKTQQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q02080 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K23 | Ubiquitination | Uniprot | |
K89 | Ubiquitination | Uniprot | |
K112 | Ubiquitination | Uniprot | |
T196 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription.
Nucleus.
Expressed in skeletal and cardiac muscle and brain.
Interacts with HDAC7 (By similarity). Heterodimer. Interacts with HDAC9.
Belongs to the MEF2 family.
Research Fields
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.