RBP5 Antibody - #DF3229
| Product: | RBP5 Antibody |
| Catalog: | DF3229 |
| Description: | Rabbit polyclonal antibody to RBP5 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 0 KD; 16kD(Calculated). |
| Uniprot: | P82980 |
| RRID: | AB_2835609 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3229, RRID:AB_2835609.
Fold/Unfold
Cellular retinol-binding protein III; CRBP III; CRBP-III; CRBP3; CRBPIII; HRBPiso; OTTHUMP00000238163; Putative cellular retinol binding protein CRBP III; RBP5; RET5_HUMAN; Retinol binding protein; Retinol binding protein 5; Retinol binding protein 5, cellular; Retinol-binding protein 5;
Immunogens
Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level).
- P82980 RET5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Intracellular transport of retinol.
Cytoplasm.
Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level).
Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.