LMO4 Antibody - #DF3223
Product: | LMO4 Antibody |
Catalog: | DF3223 |
Description: | Rabbit polyclonal antibody to LMO4 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 44 KD; 18kD(Calculated). |
Uniprot: | P61968 |
RRID: | AB_2835603 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3223, RRID:AB_2835603.
Fold/Unfold
Breast tumor autoantigen; LIM domain only 4; LIM domain only protein 4; LIM domain transcription factor LMO 4; LIM domain transcription factor LMO4; LMO 4; LMO-4; LMO4; LMO4_HUMAN; OTTHUMP00000011905; OTTHUMP00000011906;
Immunogens
- P61968 LMO4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61968 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y77 | Phosphorylation | Uniprot | |
S88 | Phosphorylation | Uniprot |
Research Backgrounds
Probable transcriptional factor.
Interacts strongly with LDBS. Interacts with DEAF1; LMO4 blocks export from nucleus. Interacts with CLIM1 and CLIM2. Interacts (via the LIM zinc-binding domain 1) with RBBP8. Interacts with BRCA1 (via the BRCT domains); the interaction represses BRCA1 transcriptional activity (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.