Product: IDH2 Recombinant Rabbit mAb
Catalog: BF4096
Description: Rabbit monoclonal antibody to IDH2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 43 kDa(Observed); 51kD(Calculated).
Uniprot: P48735

View similar products>>

Out of stock
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:100-1:200, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23543]
Specificity:
IDH2 Recombinant Rabbit mAb detects endogenous levels of IDH2.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

D2HGA2; ICD-M; IDH; IDH2; IDHM; IDHP_HUMAN; IDP; IDPM; Isocitrate dehydrogenase [NADP], mitochondrial; Isocitrate dehydrogenase 2 (NADP+), mitochondrial; mNADP-IDH; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase;

Immunogens

Immunogen:

A synthetic peptide from human IDH2

Uniprot:
Gene(ID):
Description:
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses,one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases,which localize to the mitochondrial matrix,and two NADP(+)-dependent isocitrate dehydrogenases,one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants.
Sequence:
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

Research Backgrounds

Function:

Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.

PTMs:

Acetylation at Lys-413 dramatically reduces catalytic activity. Deacetylated by SIRT3.

Subcellular Location:

Mitochondrion.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the isocitrate and isopropylmalate dehydrogenases family.

Research Fields

· Cellular Processes > Transport and catabolism > Peroxisome.   (View pathway)

· Metabolism > Carbohydrate metabolism > Citrate cycle (TCA cycle).

· Metabolism > Metabolism of other amino acids > Glutathione metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Metabolism > Global and overview maps > Carbon metabolism.

· Metabolism > Global and overview maps > 2-Oxocarboxylic acid metabolism.

· Metabolism > Global and overview maps > Biosynthesis of amino acids.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.