NCBP2 Antibody - #DF3202
| Product: | NCBP2 Antibody |
| Catalog: | DF3202 |
| Description: | Rabbit polyclonal antibody to NCBP2 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 18 KD; 18kD(Calculated). |
| Uniprot: | P52298 |
| RRID: | AB_2835582 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3202, RRID:AB_2835582.
Fold/Unfold
20 kDa nuclear cap binding protein; CBC2; CBP20; Cell proliferation inducing gene 55 protein; NCBP 2; NCBP 20 kDa subunit; NCBP interacting protein 1; NIP1; Nuclear cap binding protein subunit 2; PIG55;
Immunogens
- P52298 NCBP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P52298 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| K7 | Methylation | Uniprot | |
| K7 | Ubiquitination | Uniprot | |
| S13 | Phosphorylation | Uniprot | |
| Y14 | Phosphorylation | Uniprot | |
| S18 | Phosphorylation | Uniprot | |
| K34 | Acetylation | Uniprot | |
| K34 | Ubiquitination | Uniprot | |
| Y57 | Phosphorylation | Uniprot | |
| K75 | Acetylation | Uniprot | |
| K75 | Ubiquitination | Uniprot | |
| T79 | Phosphorylation | Uniprot | |
| Y89 | Phosphorylation | Uniprot | |
| K120 | Ubiquitination | Uniprot | |
| S130 | Phosphorylation | Uniprot | |
| Y138 | Phosphorylation | Uniprot | |
| R139 | Methylation | Uniprot | |
| Y142 | Phosphorylation | Uniprot | |
| R146 | Methylation | Uniprot | |
| K151 | Acetylation | Uniprot | |
| K151 | Methylation | Uniprot | |
| K151 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure. The conventional cap-binding complex with NCBP2 binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus.
Nucleus. Cytoplasm.
Component of the nuclear cap-binding complex (CBC), a heterodimer composed of NCBP1/CBP80 and NCBP2/CBP20 that interacts with m7GpppG-capped RNA. Found in a U snRNA export complex with PHAX/RNUXA, NCBP1/CBP80, NCBP2/CBP20, RAN, XPO1 and m7G-capped RNA. Interacts with PHAX/RNUXA, EIF4G1, HNRNPF, HNRNPH1 and ALYREF/THOC4/ALY. Interacts with SRRT/ARS2 and KPNA3.
Belongs to the RRM NCBP2 family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
· Genetic Information Processing > Translation > mRNA surveillance pathway.
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.