Out of stock
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:2000-1:20000, IHC 1:100-1:1000, ICC
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Monoclonal [ReFirm23417]
Specificity:
TSPO Recombinant Rabbit mAb detects endogenous levels of TSPO.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Benzodiazapine receptor (peripheral); Benzodiazepine peripheral binding site; BPBS; BZRP; DBI; IBP; Isoquinoline carboxamide-binding protein; MBR; mDRC; Mitochondrial benzodiazepine receptor; PBR; PBS; Peripheral benzodiazepine receptor; Peripheral benzodiazepine receptor-related protein; Peripheral type benzodiazepine receptor; Peripheral-type benzodiazepine receptor; pk18; PKBS; PTBR; Ptbzr; PTBZR02; RATPTBZR02; translocator protein (18kDa); Translocator protein; Tspo; Tspo1; TSPOA_HUMAN;

Immunogens

Immunogen:

A synthetic peptide from human TSPO

Uniprot:
Gene(ID):
Expression:
P30536 TSPO_HUMAN:

Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids.

Description:
Present mainly in the mitochondrial compartment of peripheral tissues,the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported,one of the variants lacks an internal exon and is considered non-coding,and the other variants encode the same protein.
Sequence:
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE

Research Backgrounds

Function:

Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides.

Subcellular Location:

Mitochondrion membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids.

Family&Domains:

Belongs to the TspO/BZRP family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Organismal Systems > Digestive system > Cholesterol metabolism.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.