KLF Antibody - #DF3259
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3259, RRID:AB_2835557.
Fold/Unfold
CDAN4; EKLF; EKLF PEN; Erythroid krueppel like transcription factor (EKLF) (Erythroid transcription factor); Erythroid krueppel-like transcription factor; Erythroid Kruppel like factor; Erythroid specific transcription factor EKLF; HBFQTL6; Human erythroid-specific transcription factor EKLF mRNA complete cds; INLU; Klf1; KLF1_HUMAN; Krueppel-like factor 1; Kruppel like factor 1 (erythroid); Basic transcription element binding protein 2; Basic transcription element-binding protein 2; BTE binding protein 2; BTE-binding protein 2; BTEB 2; BTEB2; CKLF; Colon krueppel like factor; Colon krueppel-like factor; GC box binding protein 2; GC-box-binding protein 2; IKLF; Intestinal enriched krueppel like factor; Intestinal-enriched krueppel-like factor; KLF 5; Klf5; KLF5_HUMAN; Krueppel like factor 5; Krueppel-like factor 5; Kruppel like factor 5 intestinal; Transcription factor BTEB 2; Transcription factor BTEB2; KLF7; KLF7_HUMAN; Krueppel like factor 7; Krueppel-like factor 7; Kruppel like factor 7; Ubiquitous krueppel like factor; Ubiquitous krueppel-like factor; UKLF;
Immunogens
Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines.
Q13887 KLF5_HUMAN:Expressed only in testis and placenta.
O75840 KLF7_HUMAN:Widely expressed.
- Q13351 KLF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL
- Q13887 KLF5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
- O75840 KLF7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRHI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13351/Q13887/O75840 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T15 | Phosphorylation | Uniprot | |
| T23 | Phosphorylation | P17612 (PRKACA) | Uniprot |
| K265 | Acetylation | Uniprot | |
| K274 | Acetylation | Uniprot | |
| K288 | Acetylation | Uniprot | |
| K297 | Sumoylation | Uniprot | |
| K297 | Ubiquitination | Uniprot | |
| T302 | Phosphorylation | Uniprot | |
| T304 | Phosphorylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K31 | Ubiquitination | Uniprot | |
| K110 | Sumoylation | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| S116 | Phosphorylation | Uniprot | |
| S153 | Phosphorylation | Q05655 (PRKCD) | Uniprot |
| K162 | Sumoylation | Uniprot | |
| K209 | Sumoylation | Uniprot | |
| S303 | Phosphorylation | P49841 (GSK3B) | Uniprot |
| T323 | Phosphorylation | Uniprot | |
| T346 | Phosphorylation | Uniprot | |
| Y359 | Phosphorylation | Uniprot | |
| S363 | Phosphorylation | Uniprot | |
| K369 | Acetylation | Uniprot | |
| Y377 | Phosphorylation | Uniprot | |
| K391 | Sumoylation | Uniprot | |
| K391 | Ubiquitination | Uniprot | |
| T396 | Phosphorylation | Uniprot | |
| T398 | Phosphorylation | Uniprot | |
| K401 | Ubiquitination | Uniprot | |
| S441 | Phosphorylation | Uniprot | |
| S443 | Phosphorylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T45 | Phosphorylation | Uniprot | |
| T189 | Phosphorylation | Uniprot | |
| S196 | Phosphorylation | Uniprot | |
| S199 | Phosphorylation | Uniprot | |
| S201 | Phosphorylation | Uniprot | |
| T242 | Phosphorylation | Uniprot | |
| T244 | Phosphorylation | Uniprot | |
| K247 | Ubiquitination | Uniprot |
Research Backgrounds
Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.
Acetylated; can be acetylated on both Lys-274 and Lys-288. Acetylation on Lys-274 (by CBP) appears to be the major site affecting EKLF transactivation activity (By similarity).
Sumoylated; sumoylation, promoted by PIAS1, leads to repression of megakaryocyte differentiation. Also promotes the interaction with the CDH4 subunit of the NuRD repression complex (By similarity).
Phosphorylated primarily on serine residues in the transactivation domain. Phosphorylation on Thr-23 is critical for the transactivation activity (By similarity).
Nucleus.
Note: Colocalizes with SUMO1 in nuclear speckles.
Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines.
Interacts with PCAF; the interaction does not acetylate EKLF and inhibits its transactivation activity (By similarity). Interacts with CREBBP/CBP and EP300; the interactions enhance the transactivation activity. Interacts with TFB1.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
Belongs to the krueppel C2H2-type zinc-finger protein family.
Transcription factor that binds to GC box promoter elements. Activates the transcription of these genes.
Ubiquitinated. Polyubiquitination involves WWP1 and leads to proteasomal degradation of this protein.
Nucleus.
Expressed only in testis and placenta.
Interacts with WWP1.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
Belongs to the krueppel C2H2-type zinc-finger protein family.
Transcriptional factor. Plays a critical role in neuronal morphogenesis and survival of sensory neurons (By similarity). Represses the corneal epithelium differentiation. Acts also as a metabolic regulator, by modulating insulin sensitivity in pancreatic beta cells and skeletal muscle cells. Inhibits transcriptional inducers of adipogenesis and has a repressive role in the expression of several adipokines, including leptin.
Nucleus.
Widely expressed.
Interacts with FBXO38.
The acidic N-terminal part may favor interaction with the basic domain of transcription factors.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. In KLF7, the motif is inactive.
Belongs to the krueppel C2H2-type zinc-finger protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.