PGE synthase Recombinant Rabbit mAb - #BF3777

(3)   Copy Info
Product: PGE synthase Recombinant Rabbit mAb
Catalog: BF3777
Description: Rabbit monoclonal antibody to PGE synthase
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 17 kDa(Observed); 17kD(Calculated).
Uniprot: O14684

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm23224]
Specificity:
PGE synthase Recombinant Rabbit mAb detects endogenous levels of PGE synthase.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Glutathione S transferase 1 like 1; MGC10317; MGST IV; MGST1 L1; MGST1 like 1; MGST1-L1; MGST1L1; MGSTIV; Microsomal glutathione S transferase 1 like 1; Microsomal glutathione S-transferase 1-like 1; Microsomal prostaglandin E synthase 1; Microsomal prostaglandin E synthase 1; mPGES 1; MPGES; mPGES-1; p53 induced apoptosis protein 12; p53 induced gene 12; p53 induced gene 12 protein; p53-induced gene 12 protein; PGES; PIG 12; PIG12; PP 102; PP 1294; PP102; PP1294; Prostaglandin E synthase; PTGES; PTGES_HUMAN; TP53I12; Tumor protein p53 inducible protein 12;

Immunogens

Immunogen:

A synthetic peptide from human PGE synthase

Uniprot:

O14684(PTGES_HUMAN) >>Visit HPA database.

Gene(ID):
PTGES(9536)
Description:
The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53,and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses.
Sequence:
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Research Backgrounds

Function:

Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).

Subcellular Location:

Membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the MAPEG family.

Research Fields

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.