BUD31 Antibody - #DF3175
| Product: | BUD31 Antibody |
| Catalog: | DF3175 |
| Description: | Rabbit polyclonal antibody to BUD31 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 17 KD; 17kD(Calculated). |
| Uniprot: | P41223 |
| RRID: | AB_2835551 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3175, RRID:AB_2835551.
Fold/Unfold
Bud31; BUD31 homolog (S. cerevisiae); BUD31_HUMAN; Cwc14; EDG 2; EDG2; fSAP17; Functional spliceosome associated protein 17; G10; G10 maternal transcript homolog; Maternal G10 transcript; Protein BUD31 homolog; Protein EDG-2; Protein G10 homolog; YCR063W;
Immunogens
Detected in epithelial and stromal cells in benign prostate hyperplasia tissue (at protein level).
- P41223 BUD31_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P41223 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K9 | Ubiquitination | Uniprot | |
| K28 | Ubiquitination | Uniprot | |
| K40 | Ubiquitination | Uniprot | |
| K42 | Sumoylation | Uniprot | |
| K42 | Ubiquitination | Uniprot | |
| K66 | Ubiquitination | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| K86 | Ubiquitination | Uniprot | |
| K91 | Ubiquitination | Uniprot | |
| K94 | Ubiquitination | Uniprot | |
| Y97 | Phosphorylation | Uniprot | |
| T115 | Phosphorylation | Uniprot | |
| K123 | Ubiquitination | Uniprot | |
| K125 | Acetylation | Uniprot | |
| K125 | Sumoylation | Uniprot | |
| K125 | Ubiquitination | Uniprot | |
| R140 | Methylation | Uniprot |
Research Backgrounds
Involved in the pre-mRNA splicing process. May play a role as regulator of AR transcriptional activity; may increase AR transcriptional activity.
Nucleus.
Note: Detected in chromatin at the promoter of AR target genes.
Detected in epithelial and stromal cells in benign prostate hyperplasia tissue (at protein level).
Identified in the spliceosome C complex. May interact with AR.
Contains a short sequence motif (Phe-Xaa-Xaa-Phe-Tyr) that can bind to AR and may modulate AR activity.
Belongs to the BUD31 (G10) family.
Research Fields
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.