CXCL11 Recombinant Rabbit mAb - #BF3742

Copy Info
Product: CXCL11 Recombinant Rabbit mAb
Catalog: BF3742
Description: Rabbit monoclonal antibody to CXCL11
Application: WB
Reactivity: Human
Mol.Wt.: 10 kDa(Observed); 10kD(Calculated).
Uniprot: O14625

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [ReFirm23189]
Specificity:
CXCL11 Recombinant Rabbit mAb detects endogenous levels of CXCL11.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

b R1; b-R1; Beta-R1; betaR1; C-X-C motif chemokine 11; Chemokine (C-X-C motif) ligand 11; Chemokine C-X-C motif ligand 11; CXC11; CXCL11; CXL11_HUMAN; H174; I TAC; I-TAC; Interferon gamma inducible protein 9; Interferon gamma-inducible protein 9; Interferon inducible T cell alpha chemoattractant; Interferon-inducible T-cell a chemoattractant I-TAC; Interferon-inducible T-cell alpha chemoattractant; IP 9; IP-9; IP9; ITAC; MGC102770; SCYB11; SCYB9B; Small inducible cytokine B11; Small inducible cytokine subfamily B (Cys-X-Cys) member 11; Small inducible cytokine subfamily B (Cys-X-Cys) member 9B; Small inducible cytokine subfamily B, member 11; Small inducible cytokine subfamily B, member 9B; Small-inducible cytokine B11;

Immunogens

Immunogen:

A synthetic peptide from human CXCL11

Uniprot:

O14625(CXL11_HUMAN) >>Visit HPA database.

Gene(ID):
CXCL11(6373)
Expression:
O14625 CXL11_HUMAN:

High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders.

Description:
Chemokines are a group of small (approximately 8 to 14 kD),mostly basic,structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane,G protein-coupled receptors. Chemokines also play fundamental roles in the development,homeostasis,and function of the immune system,and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies,CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene.
Sequence:
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Research Backgrounds

Function:

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders.

Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.