LDHB Recombinant Rabbit mAb - #BF3716
Control Products
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Epididymis secretory protein Li 281; HEL S 281; L lactate dehydrogenase B chain; L-lactate dehydrogenase B chain; Lactate dehydrogenase H chain; LDH B; LDH H; LDH heart subunit; LDH-B; LDH-H; LDHB; LDHB_HUMAN; LDHBD; LDHH; Renal carcinoma antigen NY REN 46; Renal carcinoma antigen NY-REN-46; TRG-5; TRG5;
Immunogens
A synthetic peptide from human LDHB
- P07195 LDHB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Research Backgrounds
Cytoplasm.
Belongs to the LDH/MDH superfamily. LDH family.
Research Fields
· Metabolism > Carbohydrate metabolism > Glycolysis / Gluconeogenesis.
· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.
· Metabolism > Carbohydrate metabolism > Pyruvate metabolism.
· Metabolism > Carbohydrate metabolism > Propanoate metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Endocrine system > Glucagon signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.