Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:50, IF/ICC 1:100-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm23138]
Specificity:
ALDH1A1 Recombinant Rabbit mAb detects endogenous levels of ALDH1A1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Acetaldehyde dehydrogenase 1; AHD2; AL1A1_HUMAN; ALDC; Aldehyde dehydrogenase 1 family member A1; Aldehyde dehydrogenase 1 soluble; Aldehyde dehydrogenase 1A1; Aldehyde dehydrogenase; Aldehyde dehydrogenase cytosolic; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase liver cytosolic; ALDH 1; ALDH 1A1; ALDH class 1; ALDH, liver cytosolic; ALDH-E1; ALDH1 A1; ALDH1; ALDH11; ALDH1A1; ALHDII; cytosolic; epididymis luminal protein 12; epididymis luminal protein 9; epididymis secretory sperm binding protein Li 53e; HEL-S-53e; MGC2318; PUMB1; RALDH 1; RalDH1; Retinal dehydrogenase 1;

Immunogens

Immunogen:

A synthetic peptide from human ALDH1A1

Uniprot:
Gene(ID):
Description:
The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver,cytosolic and mitochondrial,which are encoded by distinct genes,and can be distinguished by their electrophoretic mobility,kinetic properties,and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism,this gene may also be involved in the regulation of the metabolic responses to high-fat diet.
Sequence:
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS

Research Backgrounds

Function:

Can convert/oxidize retinaldehyde to retinoic acid. Binds free retinal and cellular retinol-binding protein-bound retinal (By similarity). May have a broader specificity and oxidize other aldehydes in vivo.

PTMs:

The N-terminus is blocked most probably by acetylation.

Subcellular Location:

Cytoplasm>Cytosol.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the aldehyde dehydrogenase family.

Research Fields

· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.