Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000, IHC 1:100-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm23095]
Specificity:
HSD11B1 Recombinant Rabbit mAb detects endogenous levels of HSD11B1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

11 beta HSD 1; 11 beta HSD1; 11 beta hydroxysteroid dehydrogenase 1; 11 DH; 11-beta hydroxysteroid dehydrogenase, type 1; 11-beta-HSD1; 11-beta-hydroxysteroid dehydrogenase 1; 11-DH; 11DH; Corticosteroid 11 beta dehydrogenase isozyme 1; Corticosteroid 11-beta-dehydrogenase isozyme 1; CORTRD2; DHI1_HUMAN; HDL; HSD 11; HSD11; HSD11B; HSD11B1; HSD11L; Hydroxysteroid (11 beta) dehydrogenase; Hydroxysteroid (11 beta) dehydrogenase 1; MGC13539; SDR26C1; short chain dehydrogenase/reductase family 26C, member 1;

Immunogens

Immunogen:

A synthetic peptide from human HSD11B1

Uniprot:
Gene(ID):
Expression:
P28845 DHI1_HUMAN:

Widely expressed. Highest expression in liver.

Description:
The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition,the encoded protein can catalyze the reverse reaction,the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity,and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.
Sequence:
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Research Backgrounds

Function:

Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol (By similarity).

PTMs:

Glycosylated.

Subcellular Location:

Endoplasmic reticulum membrane>Single-pass type II membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed. Highest expression in liver.

Family&Domains:

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Research Fields

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.