Cytochrome P450 27A1 Recombinant Rabbit mAb - #BF3588

(4)   Copy Info
Product: Cytochrome P450 27A1 Recombinant Rabbit mAb
Catalog: BF3588
Description: Rabbit monoclonal antibody to Cytochrome P450 27A1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 60 kDa(Observed); 60kD(Calculated).
Uniprot: Q02318

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:5000, IHC 1:100-1:200, IF/ICC 1:50-1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm23035]
Specificity:
Cytochrome P450 27A1 Recombinant Rabbit mAb detects endogenous levels of Cytochrome P450 27A1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

12-alpha-triol 27-hydroxylase; 5-beta-cholestane-3-alpha; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase; 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase; 7-alpha; Cholestanetriol 26 monooxygenase; CP27; CP27A_HUMAN; CTX; CYP; CYP27; CYP27A1; Cytochrome P 450C27/25; Cytochrome P-450C27/25; Cytochrome P450 27; Cytochrome P450 27 mitochondrial; Cytochrome P450 family 27 subfamily A polypeptide 1; Cytochrome P450 subfamily XXVIIA (steroid 27-hydroxylase cerebrotendinous xanthomatosis) polypeptide 1; mitochondrial; Sterol 26 hydroxylase; Sterol 26 hydroxylase mitochondrial; Sterol 26-hydroxylase; Sterol 27 hydroxylase; Sterol 27-hydroxylase; Vitamin D(3) 25 hydroxylase; Vitamin D(3) 25-hydroxylase;

Immunogens

Immunogen:

A synthetic peptide from human Cytochrome P450 27A1

Uniprot:

Q02318(CP27A_HUMAN) >>Visit HPA database.

Gene(ID):
CYP27A1(1593)
Expression:
Q02318 CP27A_HUMAN:

Expressed in the neural retina and underlying retinal pigment epithelium (at protein level) (PubMed:21411718). Expressed in the gray and white matter of cerebellum (at protein level) (PubMed:28190002).

Description:
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol,steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body,this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis,a rare autosomal recessive lipid storage disease.
Sequence:
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

Research Backgrounds

Function:

Cytochrome P450 monooxygenase that catalyzes regio- and stereospecific hydroxylation of cholesterol and its derivatives. Hydroxylates (with R stereochemistry) the terminal methyl group of cholesterol side-chain in a three step reaction to yield at first a C26 alcohol, then a C26 aldehyde and finally a C26 acid. Regulates cholesterol homeostasis by catalyzing the conversion of excess cholesterol to bile acids via both the 'neutral' (classic) and the 'acid' (alternative) pathways. May also regulate cholesterol homeostasis via generation of active oxysterols, which act as ligands for NR1H2 and NR1H3 nuclear receptors, modulating the transcription of genes involved in lipid metabolism. Plays a role in cholestanol metabolism in the cerebellum. Similarly to cholesterol, hydroxylates cholestanol and may facilitate sterol diffusion through the blood-brain barrier to the systemic circulation for further degradation. Also hydroxylates retinal 7-ketocholesterol, a noxious oxysterol with pro-inflammatory and pro-apoptotic effects, and may play a role in its elimination from the retinal pigment epithelium. May play a redundant role in vitamin D biosynthesis. Catalyzes 25-hydroxylation of vitamin D3 that is required for its conversion to a functionally active form.

Subcellular Location:

Mitochondrion inner membrane>Peripheral membrane protein.
Note: Post-translationally targeted to mitochondria. All three of the receptor proteins in the TOM complex, TOMM70, TOMM20 and TOMM22 are required for the translocation across the mitochondrial outer membrane. After translocation into the matrix, associates with the inner membrane as a membrane extrinsic protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the neural retina and underlying retinal pigment epithelium (at protein level). Expressed in the gray and white matter of cerebellum (at protein level).

Family&Domains:

Belongs to the cytochrome P450 family.

Research Fields

· Metabolism > Lipid metabolism > Primary bile acid biosynthesis.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Digestive system > Cholesterol metabolism.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.