APOA1 Recombinant Rabbit mAb - #BF3571

(1)   Copy Info
Product: APOA1 Recombinant Rabbit mAb
Catalog: BF3571
Description: Rabbit monoclonal antibody to APOA1
Application: WB IHC IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 25-31kD(Observed); 31kD(Calculated).
Uniprot: P02647

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:100, IF/ICC 1:100-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Monoclonal [ReFirm23018]
Specificity:
APOA1 Recombinant Rabbit mAb detects endogenous levels of APOA1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apo-AI; ApoA I; ApoA-I; APOA1; APOA1_HUMAN; Apolipoprotein A-I(1-242); Apolipoprotein A1; Apolipoprotein AI; Brp14; Ltw1; Lvtw1; Sep1; Sep2;

Immunogens

Immunogen:

A synthetic peptide from human APOA1

Uniprot:

P02647(APOA1_HUMAN) >>Visit HPA database.

Gene(ID):
APOA1(335)
Expression:
P02647 APOA1_HUMAN:

Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease.

Description:
This gene encodes apolipoprotein A-I,which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein,which promotes cholesterol efflux from tissues to the liver for excretion,and is a cofactor for lecithin cholesterolacyltransferase (LCAT),an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies,including Tangier disease,and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants,at least one of which encodes a preproprotein.
Sequence:
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Research Backgrounds

Function:

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.

PTMs:

Glycosylated.

Palmitoylated.

Phosphorylation sites are present in the extracellular medium.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease.

Family&Domains:

Belongs to the apolipoprotein A1/A4/E family.

Research Fields

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Digestive system > Fat digestion and absorption.

· Organismal Systems > Digestive system > Vitamin digestion and absorption.

· Organismal Systems > Digestive system > Cholesterol metabolism.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.