CD153 Antibody - #DF3156
Product: | CD153 Antibody |
Catalog: | DF3156 |
Description: | Rabbit polyclonal antibody to CD153 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 38 KD; 26kD(Calculated). |
Uniprot: | P32971 |
RRID: | AB_2835533 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3156, RRID:AB_2835533.
Fold/Unfold
CD153; CD153 antigen; CD30 antigen ligand; CD30 L; CD30 ligand; CD30-L; CD30L; CD30LG; MGC138144; TNFL8_HUMAN; Tnfsf8; Tumor necrosis factor (ligand) superfamily member 8; Tumor necrosis factor ligand superfamily member 8;
Immunogens
- P32971 TNFL8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P32971 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S67 | Phosphorylation | Uniprot | |
S71 | Phosphorylation | Uniprot |
Research Backgrounds
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Membrane>Single-pass type II membrane protein.
Homotrimer.
Belongs to the tumor necrosis factor family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.