Product: PPIF Antibody
Catalog: DF3147
Description: Rabbit polyclonal antibody to PPIF
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 22 KD(Observed); 22kD(Calculated).
Uniprot: P30405
RRID: AB_2835524

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(91%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
PPIF Antibody detects endogenous levels of total PPIF.
RRID:
AB_2835524
Cite Format: Affinity Biosciences Cat# DF3147, RRID:AB_2835524.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cyclophilin 3; cyclophilin D; Cyclophilin F; Cyp D; CyP M; CYP3; CypD; hCyP3; mitochondrial; Mitochondrial cyclophilin; Peptidyl prolyl cis trans isomerase, mitochondral; Peptidyl-prolyl cis-trans isomerase F; Peptidyl-prolyl cis-trans isomerase F, mitochondrial; Peptidylprolyl isomerase F (cyclophilin F); Peptidylprolyl isomerase F; PPIase; PPIase F; Ppif; PPIF_HUMAN; Rotamase; Rotamase F;

Immunogens

Immunogen:

A synthesized peptide derived from human PPIF, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Dog
100
Rabbit
100
Pig
91
Bovine
91
Sheep
91
Chicken
91
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Involved in regulation of the mitochondrial permeability transition pore (mPTP). It is proposed that its association with the mPTP is masking a binding site for inhibiting inorganic phosphate (Pi) and promotes the open probability of the mPTP leading to apoptosis or necrosis; the requirement of the PPIase activity for this function is debated. In cooperation with mitochondrial TP53 is involved in activating oxidative stress-induced necrosis. Involved in modulation of mitochondrial membrane F(1)F(0) ATP synthase activity and regulation of mitochondrial matrix adenine nucleotide levels. Has anti-apoptotic activity independently of mPTP and in cooperation with BCL2 inhibits cytochrome c-dependent apoptosis.

PTMs:

Deacetylated at Lys-167 by SIRT3.

Subcellular Location:

Mitochondrion matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the cyclophilin-type PPIase family.

Research Fields

· Environmental Information Processing > Signal transduction > Calcium signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

References

1). Emodin targets mitochondrial cyclophilin D to induce apoptosis in HepG2 cells. BIOMEDICINE & PHARMACOTHERAPY, 2017 (PubMed: 28363167) [IF=6.9]

Application: WB    Species: human    Sample:

Fig. 3. Effects of ROS and ERK on CypD expression. Cells were treated with emodin in the absence or presence of 5mM CsA or 10 ng/mL EGF for 48 h, or 5 mM NAC for 6 h. Protein expression was determined by western blots. (A) CypD expression in the absence or presence of CsA. (B) p-ERK expression induced by emodin. (C) CypD expression in the absence or presence of EGF. (D) CypD expression in the absence or presence of NAC. (E) Determination of emodin-induced cytotoxicity activity in the absence or presence of EGF or NAC by MTT assay. Values are expressed as the means  SD; n = 3, * p < 0.05 versus control.

2). Chrysophanol localizes in mitochondria to promote cell death through upregulation of mitochondrial cyclophilin D in HepG2 cells. Chinese Herbal Medicines, 2021 (PubMed: 36117497) [IF=4.7]

3). Therapeutic effect and mechanism of 4‑phenyl butyric acid on renal ischemia‑reperfusion injury in mice. Experimental and Therapeutic Medicine, 2022 (PubMed: 35069825) [IF=2.4]

Application: WB    Species: human    Sample: HK‑2 cells

Figure 2. | Expression levels of CypD, cytochrome c, eIF2α and GRP78 in HK‑2 cells following hypoxia/reoxygenation and DEX and 4‑PBA treatment. The left panel presents representative western blotting, and the right panel shows the quantified relative protein levels. *P<0.05 vs. control; #P<0.05 vs. model. CypD,cyclophilin D; eIF2α, eukaryotic translation initiation factor 2α; GRP78, glucose‑regulated protein 78.

Application: WB    Species: Human    Sample: HK-2 cells

Figure 2 Expression levels of CypD, cytochrome c, eIF2α and GRP78 in HK-2 cells following hypoxia/reoxygenation and DEX and 4-PBA treatment. The left panel presents representative western blotting, and the right panel shows the quantified relative protein levels. *P<0.05 vs. control; #P<0.05 vs. model. CypD, cyclophilin D; eIF2α, eukaryotic translation initiation factor 2α; GRP78, glucose-regulated protein 78.

4). Cyclophilin D Regulates Oxidative Stress and Apoptosis via Mitochondrial Permeability Transition Pore in Acute Acalculous Cholecystitis. CURRENT MOLECULAR MEDICINE, 2023 (PubMed: 36089783) [IF=2.2]

5). Bishonokiol A Induces Multiple Cell Death in Human Breast Cancer MCF-7 Cells. Asian Pacific Journal of Cancer Prevention, 2020 (PubMed: 32334473)

Application: WB    Species: Human    Sample: Breast Cancer MCF-7 Cells

Figure 3 BHNKA Induced Necroptosis in Human Breast Cancer MCF-7 Cells. (A), Morphological characteristics of cells treated with BHNKA (40 μM) for 24h by electron microscope. Red arrowheads indicated cell membrane integrity and swelling of cellular orgenelles. (B), Cell viability following treated with BHNKA (40 μM) with or without pre-treatment with necroptosis inhibitors (20 μM of Nec-1 and CsA) were measured by MTT assay. (C), Western blotting analyses were used to measure the expression of necroptosis-related proteins, such as RIP1, RIP3, MLKL, and CypD. * P < 0.05 compared with the control

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.