PPIF Antibody | Affinity Biosciences

WB
IHC
IF/ICC
Cites

1/10

Western blot analysis of extracts from mouse Brian cells using PPIF antibody.

Western blot analysis of extracts from HepG2 cells(H2O2 treatment), using PPIF Antibody.

DF3147 at 1/100 staining Mouse brain tissue by IHC-P.

DF3147 at 1/100 staining Rat testis tissue by IHC-P.

DF3147 staining Hela cells by IF/ICC.

DF3147 staining A549 cells by IF/ICC.

Fig.

Figure 3 BHNKA Induced Necroptosis in Human Breast Cancer MCF-7 Cells.

Figure 2.

Figure 2 Expression levels of CypD, cytochrome c, eIF2α and GRP78 in HK-2 cells following hypoxia/reoxygenation and DEX and 4-PBA treatment.

Product:	PPIF Antibody
Catalog:	DF3147
Description:	Rabbit polyclonal antibody to PPIF
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.:	22 KD; 22kD(Calculated).
Uniprot:	P30405
RRID:	AB_2835524

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(91%), Bovine(91%), Horse(100%), Sheep(91%), Rabbit(100%), Dog(100%), Chicken(91%)

Clonality:

Polyclonal

Specificity:

PPIF Antibody detects endogenous levels of total PPIF.

RRID:

AB_2835524
Cite Format: Affinity Biosciences Cat# DF3147, RRID:AB_2835524.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Cyclophilin 3; cyclophilin D; Cyclophilin F; Cyp D; CyP M; CYP3; CypD; hCyP3; mitochondrial; Mitochondrial cyclophilin; Peptidyl prolyl cis trans isomerase, mitochondral; Peptidyl-prolyl cis-trans isomerase F; Peptidyl-prolyl cis-trans isomerase F, mitochondrial; Peptidylprolyl isomerase F (cyclophilin F); Peptidylprolyl isomerase F; PPIase; PPIase F; Ppif; PPIF_HUMAN; Rotamase; Rotamase F;

Immunogens

Immunogen:

Uniprot:

P30405(PPIF_HUMAN) >>Visit HPA database.

Gene(ID):

PPIF(10105)

Sequence:

P30405 PPIF_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Horse

100

Dog

100

Rabbit

100

Pig

Bovine

Sheep

Chicken

Xenopus

Zebrafish

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P30405 As Substrate

P30405

Site	PTM Type	Enzyme	Source
S31	Phosphorylation	P31751 (AKT2)	Uniprot
S34	Phosphorylation		Uniprot
K57	Acetylation		Uniprot
K67	Acetylation		Uniprot
K73	Acetylation		Uniprot
K73	Sumoylation		Uniprot
K73	Ubiquitination		Uniprot
K86	Acetylation		Uniprot
K86	Ubiquitination		Uniprot
Y90	Phosphorylation		Uniprot
K91	Acetylation		Uniprot
S123	Phosphorylation		Uniprot
K167	Acetylation		Uniprot
K175	Acetylation		Uniprot
K182	Acetylation		Uniprot
K183	Acetylation		Uniprot
S186	Phosphorylation		Uniprot
S189	Phosphorylation		Uniprot
K190	Methylation		Uniprot
K190	Ubiquitination		Uniprot
S191	Phosphorylation		Uniprot
C203	S-Nitrosylation		Uniprot

Research Backgrounds

P30405_PPIF_HUMAN

Function:

PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Involved in regulation of the mitochondrial permeability transition pore (mPTP). It is proposed that its association with the mPTP is masking a binding site for inhibiting inorganic phosphate (Pi) and promotes the open probability of the mPTP leading to apoptosis or necrosis; the requirement of the PPIase activity for this function is debated. In cooperation with mitochondrial TP53 is involved in activating oxidative stress-induced necrosis. Involved in modulation of mitochondrial membrane F(1)F(0) ATP synthase activity and regulation of mitochondrial matrix adenine nucleotide levels. Has anti-apoptotic activity independently of mPTP and in cooperation with BCL2 inhibits cytochrome c-dependent apoptosis.

PTMs:

Deacetylated at Lys-167 by SIRT3.

Subcellular Location:

Mitochondrion matrix.

Subunit Structure:

Associates with the mitochondrial membrane ATP synthase F(1)F(0) ATP synthase; the association is increased by inorganic phosphate (Pi) and decreased by cyclosporin A (CsA). Interacts with ATP5F1B; ATP5PD and ATP5PO. Interacts with SLC25A3; the interaction is impaired by CsA. Interacts with BCL2; the interaction is impaired by CsA. Interacts with TP53; the association implicates preferentially tetrameric TP53, is induced by oxidative stress and is impaired by CsA. Interacts with C1QBP. Interacts with MCUR1. Component of the mitochondrial permeability transition pore complex (mPTPC), at least composed of SPG7, VDAC1 and PPIF. Interacts with SPG7.

Family&Domains:

Belongs to the cyclophilin-type PPIase family.

Research Fields

· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Human Diseases > Neurodegenerative diseases > Huntington's disease.

· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.

References

1). Emodin targets mitochondrial cyclophilin D to induce apoptosis in HepG2 cells. BIOMEDICINE & PHARMACOTHERAPY, 2017 (PubMed: 28363167) [IF=7.5]

Application: WB Species: human Sample:

Fig. 3. Effects of ROS and ERK on CypD expression. Cells were treated with emodin in the absence or presence of 5mM CsA or 10 ng/mL EGF for 48 h, or 5 mM NAC for 6 h. Protein expression was determined by western blots. (A) CypD expression in the absence or presence of CsA. (B) p-ERK expression induced by emodin. (C) CypD expression in the absence or presence of EGF. (D) CypD expression in the absence or presence of NAC. (E) Determination of emodin-induced cytotoxicity activity in the absence or presence of EGF or NAC by MTT assay. Values are expressed as the means SD; n = 3, * p < 0.05 versus control.

2). Chrysophanol localizes in mitochondria to promote cell death through upregulation of mitochondrial cyclophilin D in HepG2 cells. Chinese Herbal Medicines, 2021 (PubMed: 36117497) [IF=3.8]

3). Therapeutic effect and mechanism of 4‑phenyl butyric acid on renal ischemia‑reperfusion injury in mice. Experimental and Therapeutic Medicine, 2022 (PubMed: 35069825) [IF=2.7]

Application: WB Species: human Sample: HK‑2 cells

Figure 2. | Expression levels of CypD, cytochrome c, eIF2α and GRP78 in HK‑2 cells following hypoxia/reoxygenation and DEX and 4‑PBA treatment. The left panel presents representative western blotting, and the right panel shows the quantified relative protein levels. *P<0.05 vs. control; #P<0.05 vs. model. CypD,cyclophilin D; eIF2α, eukaryotic translation initiation factor 2α; GRP78, glucose‑regulated protein 78.

Application: WB Species: Human Sample: HK-2 cells

Figure 2 Expression levels of CypD, cytochrome c, eIF2α and GRP78 in HK-2 cells following hypoxia/reoxygenation and DEX and 4-PBA treatment. The left panel presents representative western blotting, and the right panel shows the quantified relative protein levels. *P<0.05 vs. control; #P<0.05 vs. model. CypD, cyclophilin D; eIF2α, eukaryotic translation initiation factor 2α; GRP78, glucose-regulated protein 78.

4). Cyclophilin D Regulates Oxidative Stress and Apoptosis via Mitochondrial Permeability Transition Pore in Acute Acalculous Cholecystitis. CURRENT MOLECULAR MEDICINE, 2023 (PubMed: 36089783) [IF=2.5]

5). Bishonokiol A Induces Multiple Cell Death in Human Breast Cancer MCF-7 Cells. Asian Pacific Journal of Cancer Prevention, 2020 (PubMed: 32334473)

Application: WB Species: Human Sample: Breast Cancer MCF-7 Cells

Figure 3 BHNKA Induced Necroptosis in Human Breast Cancer MCF-7 Cells. (A), Morphological characteristics of cells treated with BHNKA (40 μM) for 24h by electron microscope. Red arrowheads indicated cell membrane integrity and swelling of cellular orgenelles. (B), Cell viability following treated with BHNKA (40 μM) with or without pre-treatment with necroptosis inhibitors (20 μM of Nec-1 and CsA) were measured by MTT assay. (C), Western blotting analyses were used to measure the expression of necroptosis-related proteins, such as RIP1, RIP3, MLKL, and CypD. * P < 0.05 compared with the control

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

PPIF Antibody - #DF3147