PPIF Antibody - #DF3147

Product: | PPIF Antibody |
Catalog: | DF3147 |
Description: | Rabbit polyclonal antibody to PPIF |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 22 KD; 22kD(Calculated). |
Uniprot: | P30405 |
RRID: | AB_2835524 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3147, RRID:AB_2835524.
Fold/Unfold
Cyclophilin 3; cyclophilin D; Cyclophilin F; Cyp D; CyP M; CYP3; CypD; hCyP3; mitochondrial; Mitochondrial cyclophilin; Peptidyl prolyl cis trans isomerase, mitochondral; Peptidyl-prolyl cis-trans isomerase F; Peptidyl-prolyl cis-trans isomerase F, mitochondrial; Peptidylprolyl isomerase F (cyclophilin F); Peptidylprolyl isomerase F; PPIase; PPIase F; Ppif; PPIF_HUMAN; Rotamase; Rotamase F;
Immunogens
- P30405 PPIF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P30405 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S31 | Phosphorylation | P31751 (AKT2) | Uniprot |
S34 | Phosphorylation | Uniprot | |
K57 | Acetylation | Uniprot | |
K67 | Acetylation | Uniprot | |
K73 | Acetylation | Uniprot | |
K73 | Sumoylation | Uniprot | |
K73 | Ubiquitination | Uniprot | |
K86 | Acetylation | Uniprot | |
K86 | Ubiquitination | Uniprot | |
Y90 | Phosphorylation | Uniprot | |
K91 | Acetylation | Uniprot | |
S123 | Phosphorylation | Uniprot | |
K167 | Acetylation | Uniprot | |
K175 | Acetylation | Uniprot | |
K182 | Acetylation | Uniprot | |
K183 | Acetylation | Uniprot | |
S186 | Phosphorylation | Uniprot | |
S189 | Phosphorylation | Uniprot | |
K190 | Methylation | Uniprot | |
K190 | Ubiquitination | Uniprot | |
S191 | Phosphorylation | Uniprot | |
C203 | S-Nitrosylation | Uniprot |
Research Backgrounds
PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Involved in regulation of the mitochondrial permeability transition pore (mPTP). It is proposed that its association with the mPTP is masking a binding site for inhibiting inorganic phosphate (Pi) and promotes the open probability of the mPTP leading to apoptosis or necrosis; the requirement of the PPIase activity for this function is debated. In cooperation with mitochondrial TP53 is involved in activating oxidative stress-induced necrosis. Involved in modulation of mitochondrial membrane F(1)F(0) ATP synthase activity and regulation of mitochondrial matrix adenine nucleotide levels. Has anti-apoptotic activity independently of mPTP and in cooperation with BCL2 inhibits cytochrome c-dependent apoptosis.
Deacetylated at Lys-167 by SIRT3.
Mitochondrion matrix.
Associates with the mitochondrial membrane ATP synthase F(1)F(0) ATP synthase; the association is increased by inorganic phosphate (Pi) and decreased by cyclosporin A (CsA). Interacts with ATP5F1B; ATP5PD and ATP5PO. Interacts with SLC25A3; the interaction is impaired by CsA. Interacts with BCL2; the interaction is impaired by CsA. Interacts with TP53; the association implicates preferentially tetrameric TP53, is induced by oxidative stress and is impaired by CsA. Interacts with C1QBP. Interacts with MCUR1. Component of the mitochondrial permeability transition pore complex (mPTPC), at least composed of SPG7, VDAC1 and PPIF. Interacts with SPG7.
Belongs to the cyclophilin-type PPIase family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
References
Application: WB Species: human Sample:
Application: WB Species: human Sample: HK‑2 cells
Application: WB Species: Human Sample: HK-2 cells
Application: WB Species: Human Sample: Breast Cancer MCF-7 Cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.