Product: CCL4 Recombinant Rabbit mAb
Catalog: BF3400
Description: Rabbit monoclonal antibody to CCL4
Application: WB IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 12 kDa(Observed); 10kD(Calculated).
Uniprot: P13236

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:10000, IF/ICC 1:100
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Monoclonal [ReFirm22847]
Specificity:
CCL4 Recombinant Rabbit mAb detects endogenous levels of CCL4.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

MIP 1 beta; Secreted protein G 26; ACT 2; ACT-2; ACT2; AT744.1; AT744.2; C C motif chemokine 4; C C motif chemokine 4 like; C C motif chemokine ligand 4 like 1; C C motif chemokine ligand 4 like 2; CC chemokine ligand 4; CC chemokine ligand 4L1; CC chemokine ligand 4L1d2; CC chemokine ligand 4L2; CCL4; CCL4_HUMAN; ccl4l 1; CCL4L; CCL4L1; Chemokine (C C motif) ligand 4; Chemokine (C C motif) ligand 4 like 1; Chemokine (C C motif) ligand 4 like 1, telomeric; Chemokine (C C motif) ligand 4 like 2; Chemokine CC Motif Ligand 4; G 26; G 26 T lymphocyte secreted protein; G-26 T-lymphocyte-secreted protein; HC21; Immune activation 2; LAG 1; LAG-1; LAG1; Lymphocyte activation gene 1; Lymphocyte activation gene 1 protein; Macrophage inflammatory protein 1 beta; Macrophage inflammatory protein 1-beta; Macrophage inflammatory protein 1b2; MGC104418; MGC126025; MGC126026; MIP-1-beta; MIP-1-beta(1-69); MIP-1-beta(3-69); MIP1 beta; MIP1B; MIP1B1; Monocyte adherence induced protein 5 alpha; PAT 744; Protein H400; SCYA2; SCYA4; SCYA4L; SCYA4L1; SCYA4L2; SCYQ4L2; Secreted protein G 26; Secreted protein G26; SIS gamma; SIS-gamma; Small inducible cytokine A4 (homologous to mouse Mip 1b); Small inducible cytokine A4; small inducible cytokine A4-like; Small-inducible cytokine A4; T cell activation protein 2; T-cell activation protein 2;

Immunogens

Immunogen:

A synthetic peptide from human CCL4

Uniprot:
Gene(ID):
Description:
The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions.
Sequence:
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Research Backgrounds

Function:

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.

PTMs:

N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.