CALR Antibody - #DF3139

(5)   (6)  
Product: CALR Antibody
Catalog: DF3139
Description: Rabbit polyclonal antibody to CALR
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Xenopus
Mol.Wt.: 62 KD; 48kD(Calculated).
Uniprot: P27797
RRID: AB_2835516

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(91%), Zebrafish(91%), Bovine(91%), Horse(91%), Sheep(91%), Rabbit(91%), Xenopus(91%)
Clonality:
Polyclonal
Specificity:
CALR Antibody detects endogenous levels of total CALR.
RRID:
AB_2835516
Cite Format: Affinity Biosciences Cat# DF3139, RRID:AB_2835516.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Autoantigen RO; CALR; CALR protein; CALR_HUMAN; Calregulin; Calreticulin; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; Epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL S 99n; RO; Sicca syndrome antigen A (autoantigen Ro; calreticulin); Sicca syndrome antigen A; SSA;

Immunogens

Immunogen:
Uniprot:

P27797(CALR_HUMAN) >>Visit HPA database.

Gene(ID):
CALR(811)
Sequence:
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
91
Horse
91
Bovine
91
Sheep
91
Xenopus
91
Zebrafish
91
Rabbit
91
Dog
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P27797 As Substrate

Site PTM Type Enzyme
Y22 Phosphorylation
K24 Sumoylation
K24 Ubiquitination
T34 Phosphorylation
S35 Phosphorylation
K41 Ubiquitination
S44 Phosphorylation
K48 Acetylation
K48 Ubiquitination
S52 Phosphorylation
S53 Phosphorylation
K55 Ubiquitination
Y57 Phosphorylation
K62 Acetylation
K62 Ubiquitination
K64 Acetylation
K64 Ubiquitination
R73 Methylation
Y75 Phosphorylation
S78 Phosphorylation
S80 Phosphorylation
S85 Phosphorylation
C105 S-Nitrosylation
Y109 Phosphorylation
K111 Methylation
K142 Acetylation
K143 Ubiquitination
Y150 Phosphorylation
K151 Ubiquitination
K153 Acetylation
K153 Ubiquitination
K159 Acetylation
K159 Ubiquitination
T169 Phosphorylation
Y172 Phosphorylation
T181 Phosphorylation
Y182 Phosphorylation
S195 Phosphorylation
K206 Acetylation
K206 Ubiquitination
K207 Acetylation
K207 Ubiquitination
K209 Acetylation
K209 Ubiquitination
S214 Phosphorylation
R222 Methylation
T229 Phosphorylation
S231 Phosphorylation
K238 Acetylation
K238 Methylation
Y271 Phosphorylation
Y285 Phosphorylation
Y299 Phosphorylation
S300 Phosphorylation
T333 Phosphorylation
N344 N-Glycosylation
K351 Ubiquitination
R366 Methylation

Research Backgrounds

Function:

Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity).

Subcellular Location:

Endoplasmic reticulum lumen. Cytoplasm>Cytosol. Secreted>Extracellular space>Extracellular matrix. Cell surface. Sarcoplasmic reticulum lumen.
Note: Also found in cell surface (T cells), cytosol and extracellular matrix (PubMed:10358038). Associated with the lytic granules in the cytolytic T-lymphocytes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Monomer. Component of an EIF2 complex at least composed of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1 and HSPA5. Interacts with PDIA3/ERp57 and SPACA9 (By similarity). Interacts with TRIM21. Interacts with NR3C1. Interacts with PPIB. Interacts (via P-domain) with PDIA5. Interacts with GABARAP. Interacts with HLA-E-B2M and HLA-G-B2M complexes. Interacts with HLA-F. Interacts with CLCC1.

Family&Domains:

Can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. The P-domain binds one molecule of calcium with high affinity, whereas the acidic C-domain binds multiple calcium ions with low affinity.

The interaction with glycans occurs through a binding site in the globular lectin domain.

The zinc binding sites are localized to the N-domain.

Associates with PDIA3 through the tip of the extended arm formed by the P-domain.

Belongs to the calreticulin family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

References

1). Mitochondrial Disruption Nanosystem Simultaneously Depressed Programmed Death Ligand-1 and Transforming Growth Factor-β to Overcome Photodynamic Immunotherapy Resistance. ACS nano, 2024 (PubMed: 38227812) [IF=17.1]
2). Lenvatinib- and vadimezan-loaded synthetic high-density lipoprotein for combinational immunochemotherapy of metastatic triple-negative breast cancer. Acta Pharmaceutica Sinica B, 2022 (PubMed: 36176911) [IF=14.5]

Application: IF/ICC    Species: Mouse    Sample: 4T1 cells

Figure 3. Uptake and efficacy of sHDLs. (A) Flow cytometry analysis of time-dependent cellular uptake of Cy5-labelled sHDL by 4T1 cells. (B) Confocal images of 4T1 cells treated with Cy5-labelled sHDL at different time points. The nucleus and β-actin were stained with DAPI and Actin-Tracker Green, respectively. Scale bar = 20 μm. (C) Cell viability of 4T1 cells after 48 h exposure to LEN, L-sHDL, and LV-sHDL of various concentrations. Quantification of extracellular ATP (D) and HMGB1 (E) in the medium of 4T1 cells after the treatment of different sHDLs. (F) Confocal images of 4T1 cells after 4 h treatment with different sHDLs and another 12 h incubation with medium. The nucleus, HMGB1, and CRT were stained with DAPI, anti-HMGB1 antibody-Alexa Fluor® 647, and anti-CRT antibody-Alexa Fluor® 488, respectively. Scale bar = 20 μm. (G) Quantification of IFN-α and IFN-β secreted by 4T1 cells after the treatment of different sHDLs. Statistical significance was calculated using a two-sided one-way ANOVA test. The data are presented as the mean ± SD (n = 3).
3). Mitochondrial metabolism blockade nanoadjuvant reversed immune-resistance microenvironment to sensitize albumin-bound paclitaxel-based chemo-immunotherapy. Acta pharmaceutica Sinica. B, 2024 (PubMed: 39309498) [IF=14.5]
4). Multifunctional 3D-printed scaffolds eradiate orthotopic osteosarcoma and promote osteogenesis via microwave thermo-chemotherapy combined with immunotherapy. Biomaterials, 2023 (PubMed: 37506512) [IF=14.0]
5). In Situ Tumor Vaccination with Calcium-Linked Degradable Coacervate Nanocomplex Co-Delivering Photosensitizer and TLR7/8 Agonist to Trigger Effective Anti-Tumor Immune Responses. Advanced Healthcare Materials, 2022 (PubMed: 35285581) [IF=10.0]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.