Product Info

Source:
Rabbit IgG
Application:
WB 1:1000-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [ReFirm22795]
Specificity:
PLA2G2A Recombinant Rabbit mAb detects endogenous levels of PLA2G2A.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EC 3.1.1.4; GIIC sPLA2; Group IIA phospholipase A2; membrane associated; MOM1; Non pancreatic secretory phospholipase A2; Non-pancreatic secretory phospholipase A2; NPS PLA2; NPS-PLA2; NPSPLA2; PA2GA_HUMAN; Phosphatidylcholine 2 acylhydrolase; Phosphatidylcholine 2-acylhydrolase 2A; Phospholipase A2; Phospholipase A2 group IIA (platelets synovial fluid); Phospholipase A2 membrane associated precursor; PLA2; PLA2B; PLA2G2A; PLA2L; PLA2S; PLAS1; RASF A; RASFA; sPLA2;

Immunogens

Immunogen:

A synthetic peptide from human PLA2G2A

Uniprot:
Gene(ID):
Description:
The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence,function,localization,and divalent cation requirements. This gene product belongs to group II,which contains secreted form of PLA2,an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides,releasing free fatty acids and lysophospholipids,and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.
Sequence:
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC

Research Backgrounds

Function:

Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Thought to participate in the regulation of phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Independent of its catalytic activity, acts as a ligand for integrins. Binds to and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1. Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1. Induces cell proliferation in an integrin-dependent manner.

Subcellular Location:

Cell membrane>Peripheral membrane protein. Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the phospholipase A2 family.

Research Fields

· Environmental Information Processing > Signal transduction > Ras signaling pathway.   (View pathway)

· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.

· Metabolism > Lipid metabolism > Ether lipid metabolism.

· Metabolism > Lipid metabolism > Arachidonic acid metabolism.

· Metabolism > Lipid metabolism > Linoleic acid metabolism.

· Metabolism > Lipid metabolism > alpha-Linolenic acid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.   (View pathway)

· Organismal Systems > Digestive system > Pancreatic secretion.

· Organismal Systems > Digestive system > Fat digestion and absorption.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.