HMGB2 Antibody - #DF3133
Product: | HMGB2 Antibody |
Catalog: | DF3133 |
Description: | Rabbit polyclonal antibody to HMGB2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 27 KD; 24kD(Calculated). |
Uniprot: | P26583 |
RRID: | AB_2835510 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3133, RRID:AB_2835510.
Fold/Unfold
C80539; High mobility group (nonhistone chromosomal) protein 2; High mobility group box 2; High mobility group protein 2; High mobility group protein B2; HMG 2; HMG B2; HMG-2; HMG2; HMGB2; HMGB2_HUMAN;
Immunogens
- P26583 HMGB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P26583 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K3 | Acetylation | Uniprot | |
R10 | Methylation | Uniprot | |
K12 | Acetylation | Uniprot | |
K12 | Ubiquitination | Uniprot | |
S15 | Phosphorylation | Uniprot | |
Y16 | Phosphorylation | Uniprot | |
R24 | Methylation | Uniprot | |
K30 | Acetylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
S35 | Phosphorylation | Uniprot | |
S42 | Phosphorylation | Uniprot | |
K43 | Acetylation | Uniprot | |
K43 | Ubiquitination | Uniprot | |
K44 | Acetylation | Uniprot | |
K44 | Ubiquitination | Uniprot | |
K50 | Ubiquitination | Uniprot | |
T51 | Phosphorylation | Uniprot | |
S53 | Phosphorylation | Uniprot | |
K55 | Acetylation | Uniprot | |
K55 | Ubiquitination | Uniprot | |
K59 | Acetylation | Uniprot | |
K59 | Ubiquitination | Uniprot | |
S66 | Phosphorylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
Y78 | Phosphorylation | Uniprot | |
K85 | Acetylation | Uniprot | |
S100 | Phosphorylation | Uniprot | |
S107 | Phosphorylation | Uniprot | |
R110 | Methylation | Uniprot | |
K112 | Methylation | Uniprot | |
K114 | Ubiquitination | Uniprot | |
S115 | Phosphorylation | Uniprot | |
S121 | Phosphorylation | Uniprot | |
K127 | Ubiquitination | Uniprot | |
K128 | Ubiquitination | Uniprot | |
S134 | Phosphorylation | Uniprot | |
S137 | Phosphorylation | Uniprot | |
K139 | Acetylation | Uniprot | |
K139 | Ubiquitination | Uniprot | |
K141 | Ubiquitination | Uniprot | |
K147 | Acetylation | Uniprot | |
K147 | Ubiquitination | Uniprot | |
K150 | Ubiquitination | Uniprot | |
K154 | Acetylation | Uniprot | |
Y155 | Phosphorylation | Uniprot | |
K157 | Acetylation | Uniprot | |
K157 | Ubiquitination | Uniprot | |
Y162 | Phosphorylation | Uniprot | |
S168 | Phosphorylation | Uniprot | |
K172 | Acetylation | Uniprot | |
K173 | Acetylation | Uniprot | |
T179 | Phosphorylation | Uniprot | |
S181 | Phosphorylation | Uniprot | |
K182 | Acetylation | Uniprot | |
K183 | Acetylation | Uniprot |
Research Backgrounds
Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity. Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) (By similarity). Proposed to be involved in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor which cooperates with subsequent discriminative sensing by specific pattern recognition receptors (By similarity). In the extracellular compartment acts as a chemokine. Promotes proliferation and migration of endothelial cells implicating AGER/RAGE. Has antimicrobial activity in gastrointestinal epithelial tissues. Involved in inflammatory response to antigenic stimulus coupled with proinflammatory activity (By similarity). Involved in modulation of neurogenesis probably by regulation of neural stem proliferation (By similarity). Involved in articular cartilage surface maintenance implicating LEF1 and the Wnt/beta-catenin pathway (By similarity).
Reduction/oxidation of cysteine residues Cys-23, Cys-45 and Cys-106 and a possible intramolecular disulfide bond involving Cys-23 and Cys-45 give rise to different redox forms with specific functional activities in various cellular compartments: 1- fully reduced HMGB2 (HMGB2C23hC45hC106h), 2- disulfide HMGB2 (HMGB2C23-C45C106h) and 3- sulfonyl HMGB2 (HMGB2C23soC45soC106so).
Acetylation enhances nucleosome binding and chromation remodeling activity.
Nucleus. Chromosome. Cytoplasm. Secreted.
Note: In basal state predominantly nuclear.
Expressed in gastric and intestinal tissues (at protein level).
Interacts with POU2F2, POU2F1 and POU3F1 (By similarity). Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2 (By similarity). Component of the SET complex, composed of at least ANP32A, APEX1, HMGB2, NME1, SET and TREX1. Directly interacts with SET. Interacts with LEF1 (By similarity).
Both, HMG box 1 and HMG box 2, show antimicrobial activity.
Belongs to the HMGB family.
References
Application: IHC Species: Mice Sample: cartilage tissue
Application: WB Species: Mice Sample: cartilage tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.