DGKA Antibody - #DF3127
Product: | DGKA Antibody |
Catalog: | DF3127 |
Description: | Rabbit polyclonal antibody to DGKA |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 80 KD; 83kD(Calculated). |
Uniprot: | P23743 |
RRID: | AB_2835504 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3127, RRID:AB_2835504.
Fold/Unfold
80 kDa diacylglycerol kinase; DAG kinase alpha; DAGK; DAGK1; DGK alpha; DGK-alpha; dgkA; DGKA_HUMAN; Diacylglycerol kinase alpha; Diacylglycerol kinase, alpha 80kDa; Diglyceride kinase alpha; MGC12821; MGC42356; OTTHUMP00000242836; OTTHUMP00000242955; OTTHUMP00000244046;
Immunogens
- P23743 DGKA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
PTMs - P23743 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K18 | Ubiquitination | Uniprot | |
Y22 | Phosphorylation | Uniprot | |
S23 | Phosphorylation | Uniprot | |
T24 | Phosphorylation | Uniprot | |
K25 | Ubiquitination | Uniprot | |
K26 | Ubiquitination | Uniprot | |
K32 | Ubiquitination | Uniprot | |
K41 | Ubiquitination | Uniprot | |
Y50 | Phosphorylation | Uniprot | |
K211 | Ubiquitination | Uniprot | |
Y218 | Phosphorylation | Uniprot | |
K239 | Ubiquitination | Uniprot | |
K249 | Ubiquitination | Uniprot | |
K260 | Ubiquitination | Uniprot | |
K263 | Ubiquitination | Uniprot | |
Y335 | Phosphorylation | P06239 (LCK) , P12931 (SRC) | Uniprot |
S348 | Phosphorylation | Uniprot | |
K353 | Acetylation | Uniprot | |
K353 | Ubiquitination | Uniprot | |
K384 | Ubiquitination | Uniprot | |
K411 | Ubiquitination | Uniprot | |
K422 | Ubiquitination | Uniprot | |
K484 | Acetylation | Uniprot | |
K484 | Ubiquitination | Uniprot | |
K487 | Ubiquitination | Uniprot | |
S492 | Phosphorylation | Uniprot | |
K493 | Ubiquitination | Uniprot | |
K543 | Ubiquitination | Uniprot | |
K547 | Ubiquitination | Uniprot | |
Y623 | Phosphorylation | Uniprot | |
K634 | Ubiquitination | Uniprot | |
T637 | Phosphorylation | Uniprot | |
K643 | Ubiquitination | Uniprot | |
K652 | Ubiquitination | Uniprot | |
Y669 | Phosphorylation | Uniprot | |
T670 | Phosphorylation | Uniprot | |
K681 | Ubiquitination | Uniprot | |
K691 | Ubiquitination | Uniprot | |
K714 | Ubiquitination | Uniprot | |
S735 | Phosphorylation | Uniprot |
Research Backgrounds
Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
Lymphocytes and oligodendroglial cells.
Monomer.
Belongs to the eukaryotic diacylglycerol kinase family.
Research Fields
· Environmental Information Processing > Signal transduction > Phosphatidylinositol signaling system.
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Choline metabolism in cancer. (View pathway)
· Metabolism > Lipid metabolism > Glycerolipid metabolism.
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.