Product: DGKA Antibody
Catalog: DF3127
Source: Rabbit
Application: WB, IHC, IF/ICC, ELISA(peptide)
Reactivity: Human
Mol.Wt.: 80 kD; 83kD(Calculated).
Uniprot: P23743
RRID: AB_2835504

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
DGKA Antibody detects endogenous levels of total DGKA.
RRID:
AB_2835504
Cite Format: Affinity Biosciences Cat# DF3127, RRID:AB_2835504.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

80 kDa diacylglycerol kinase; DAG kinase alpha; DAGK; DAGK1; DGK alpha; DGK-alpha; dgkA; DGKA_HUMAN; Diacylglycerol kinase alpha; Diacylglycerol kinase, alpha 80kDa; Diglyceride kinase alpha; MGC12821; MGC42356; OTTHUMP00000242836; OTTHUMP00000242955; OTTHUMP00000244046;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P23743 DGKA_HUMAN:

Lymphocytes and oligodendroglial cells.

Sequence:
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

PTMs - P23743 As Substrate

Site PTM Type Enzyme
K18 Ubiquitination
Y22 Phosphorylation
S23 Phosphorylation
T24 Phosphorylation
K25 Ubiquitination
K26 Ubiquitination
K32 Ubiquitination
K41 Ubiquitination
Y50 Phosphorylation
K211 Ubiquitination
Y218 Phosphorylation
K239 Ubiquitination
K249 Ubiquitination
K260 Ubiquitination
K263 Ubiquitination
Y335 Phosphorylation P06239 (LCK) , P12931 (SRC)
S348 Phosphorylation
K353 Acetylation
K353 Ubiquitination
K384 Ubiquitination
K411 Ubiquitination
K422 Ubiquitination
K484 Acetylation
K484 Ubiquitination
K487 Ubiquitination
S492 Phosphorylation
K493 Ubiquitination
K543 Ubiquitination
K547 Ubiquitination
Y623 Phosphorylation
K634 Ubiquitination
T637 Phosphorylation
K643 Ubiquitination
K652 Ubiquitination
Y669 Phosphorylation
T670 Phosphorylation
K681 Ubiquitination
K691 Ubiquitination
K714 Ubiquitination
S735 Phosphorylation

Research Backgrounds

Function:

Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.

Tissue Specificity:

Lymphocytes and oligodendroglial cells.

Subunit Structure:

Monomer.

Family&Domains:

Belongs to the eukaryotic diacylglycerol kinase family.

Research Fields

· Environmental Information Processing > Signal transduction > Phosphatidylinositol signaling system.

· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Choline metabolism in cancer.   (View pathway)

· Metabolism > Lipid metabolism > Glycerolipid metabolism.

· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.