MOS Antibody - #DF3067
Product: | MOS Antibody |
Catalog: | DF3067 |
Description: | Rabbit polyclonal antibody to MOS |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Zebrafish, Bovine, Chicken, Xenopus |
Mol.Wt.: | 40 KD; 38kD(Calculated). |
Uniprot: | P00540 |
RRID: | AB_2835450 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3067, RRID:AB_2835450.
Fold/Unfold
c mos; MGC119962; MGC119963; MOS; MOS_HUMAN; MSV; Oocyte maturation factor mos; Proto oncogene serine / threonine protein kinase mos; Proto-oncogene c-Mos; Proto-oncogene serine/threonine-protein kinase mos; v mos Moloney murine sarcoma viral oncogene homolog;
Immunogens
- P00540 MOS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P00540 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S3 | Phosphorylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
Y263 | Phosphorylation | Uniprot | |
T339 | Phosphorylation | Uniprot | |
S340 | Phosphorylation | Uniprot |
PTMs - P00540 As Enzyme
Research Backgrounds
Expressed specifically in testis during spermatogenesis.
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Research Fields
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.