CBX6 Antibody - #DF3060
Product: | CBX6 Antibody |
Catalog: | DF3060 |
Description: | Rabbit polyclonal antibody to CBX6 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Chicken, Xenopus |
Mol.Wt.: | 44 KD; 44kD(Calculated). |
Uniprot: | O95503 |
RRID: | AB_2835443 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3060, RRID:AB_2835443.
Fold/Unfold
Cbx 6; Cbx6; CBX6_HUMAN; Chromobox homolog 6; Chromobox protein homolog 6;
Immunogens
- O95503 CBX6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95503 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K18 | Ubiquitination | Uniprot | |
K33 | Ubiquitination | Uniprot | |
K38 | Ubiquitination | Uniprot | |
Y39 | Phosphorylation | Uniprot | |
K60 | Ubiquitination | Uniprot | |
K82 | Ubiquitination | Uniprot | |
K100 | Acetylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
S106 | Phosphorylation | Uniprot | |
S107 | Phosphorylation | Uniprot | |
S130 | Phosphorylation | Uniprot | |
S143 | Phosphorylation | Uniprot | |
S151 | Phosphorylation | Uniprot | |
T156 | Phosphorylation | Uniprot | |
K179 | Ubiquitination | Uniprot | |
K183 | Ubiquitination | Uniprot | |
K214 | Ubiquitination | Uniprot | |
K236 | Ubiquitination | Uniprot | |
S246 | Phosphorylation | Uniprot | |
S280 | Phosphorylation | Uniprot | |
T282 | Phosphorylation | Uniprot | |
S285 | Phosphorylation | Uniprot | |
S301 | Phosphorylation | Uniprot | |
S303 | Phosphorylation | Uniprot |
Research Backgrounds
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Possibly contributes to the target selectivity of the PRC1 complex by binding specific regions of chromatin. Recruitment to chromatin might occur in an H3K27me3-independent fashion (By similarity). May have a PRC1-independent function in embryonic stem cells (By similarity).
Nucleus. Chromosome.
Note: Uniformely distributed in the nucleoplasm (PubMed:18927235). Localizes to the inactivated X chromosome in females (By similarity).
Component of a PRC1-like complex. Distinct PRC1-like core complexes are composed of a RING1 subunit (RING1B or RING1A), one of the six PCGF proteins (PCGF1-6), one PHC protein (PHC1-3) and one of the CBX proteins (CBX2, CBX4, CBX6, CBX7 or CBX8). Interacts with PCGF1, PCGF2, PCGF3, BMI1, PCGF5, PCGF6, RING1 and RNF2. May interact with HIST2H3A and HIST1H3A. Interacts (via chromodomain) with single-stranded RNA (ssRNA) (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.