SIX6 Antibody - #DF3059
| Product: | SIX6 Antibody |
| Catalog: | DF3059 |
| Description: | Rabbit polyclonal antibody to SIX6 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 28 KD; 28kD(Calculated). |
| Uniprot: | O95475 |
| RRID: | AB_2835442 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3059, RRID:AB_2835442.
Fold/Unfold
Homeobox protein SIX6; Homeodomain protein OPTX2; MCOPCT 2; MCOPCT2; Optic homeobox 2; OPTX 2; OPTX2; Sine oculis homeobox homolog 6; SIX 6; Six 9; SIX homeobox 6; Six6; SIX6_HUMAN; Six9;
Immunogens
Expressed in the developing and adult retina. Also expressed in the hypothalamic and the pituitary regions.
- O95475 SIX6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95475 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S10 | Phosphorylation | Uniprot | |
| K49 | Ubiquitination | Uniprot | |
| Y96 | Phosphorylation | Uniprot | |
| K112 | Ubiquitination | Uniprot | |
| K131 | Ubiquitination | Uniprot | |
| K136 | Ubiquitination | Uniprot | |
| Y147 | Phosphorylation | Uniprot | |
| Y152 | Phosphorylation | Uniprot | |
| S156 | Phosphorylation | Uniprot | |
| S198 | Phosphorylation | Uniprot | |
| S201 | Phosphorylation | Uniprot | |
| T212 | Phosphorylation | Uniprot | |
| T220 | Phosphorylation | Uniprot | |
| S221 | Phosphorylation | Uniprot | |
| S225 | Phosphorylation | Uniprot | |
| S227 | Phosphorylation | Uniprot | |
| S228 | Phosphorylation | Uniprot |
Research Backgrounds
May be involved in eye development.
Nucleus.
Expressed in the developing and adult retina. Also expressed in the hypothalamic and the pituitary regions.
Interacts with TLE4 and TLE5.
Belongs to the SIX/Sine oculis homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.