Renin receptor Antibody - #DF3047
| Product: | Renin receptor Antibody | 
| Catalog: | DF3047 | 
| Description: | Rabbit polyclonal antibody to Renin receptor | 
| Application: | WB IHC IF/ICC | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken, Xenopus | 
| Mol.Wt.: | 39 KD; 39kD(Calculated). | 
| Uniprot: | O75787 | 
| RRID: | AB_2835430 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3047, RRID:AB_2835430.
Fold/Unfold
APT6M8 9; APT6M8-9; ATP6AP2; ATP6IP2; ATP6M8-9; ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase H+ transporting lysosomal accessory protein 2; ATPase H+ transporting lysosomal interacting protein 2; ATPase H+ transporting lysosomal vacuolar proton pump membrane sector associated protein M8 9; ATPase membrane sector associated protein M8 9; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8 9; CAPER; ELDF10; Embryonic liver differentiation factor 10; ER localized type I transmembrane adaptor; ER-localized type I transmembrane adaptor; HT028; M8 9; M8-9; MGC99577; MRXE; MSTP009; N14F; Renin receptor; Renin/prorenin receptor; RENR_HUMAN; V ATPase M8 9 subunit; V ATPase M8.9 subunit; V-ATPase M8.9 subunit; Vacuolar ATP synthase membrane sector associated protein M8 9; Vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8 9; XMRE;
Immunogens
A synthesized peptide derived from human Renin receptor, corresponding to a region within the internal amino acids.
Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in the subendothelium, associated to smooth muscles where it colocalizes with REN. Expressed in vascular structures and by syncytiotrophoblast cells in the mature fetal placenta.
- O75787 RENR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Multifunctional protein which functions as a renin, prorenin cellular receptor and is involved in the assembly of the proton-transporting vacuolar (V)-ATPase protein pump. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS). Probably by controlling the assembly of the V-ATPase pump and thus the acidification of the endo-lysosomal system, plays a role in many neuronal processes including synapse morphology and synaptic transmission (By similarity).
Phosphorylated.
Proteolytically cleaved by a furin-like convertase in the trans-Golgi network to generate N- and C-terminal fragments.
Endoplasmic reticulum membrane>Single-pass type I membrane protein. Lysosome membrane. Cytoplasmic vesicle>Autophagosome membrane. Cell projection>Dendritic spine membrane. Cell projection>Axon. 
Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in the subendothelium, associated to smooth muscles where it colocalizes with REN. Expressed in vascular structures and by syncytiotrophoblast cells in the mature fetal placenta.
Research Fields
· Organismal Systems > Endocrine system > Renin-angiotensin system. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.
 
											 
											 
											