ER81 Antibody - #DF3193
| Product: | ER81 Antibody |
| Catalog: | DF3193 |
| Description: | Rabbit polyclonal antibody to ER81 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 60 KD; 55kD(Calculated). |
| Uniprot: | P50549 |
| RRID: | AB_2835416 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3193, RRID:AB_2835416.
Fold/Unfold
DKFZp781L0674; ER81; ER81 protein; ER81, mouse, homolog of; ETS translocation variant 1; ets variant gene 1; Ets-related protein 81; Etsrp81; ETV 1; ETV1; ETV1_HUMAN; MGC104699; MGC120533; MGC120534;
Immunogens
Very highly expressed in brain, highly expressed in testis, lung and heart, moderately in spleen, small intestine, pancreas and colon, weakly in liver, prostate and thymus, very weakly in skeletal muscle, kidney and ovary and not in placenta and peripheral blood leukocytes.
- P50549 ETV1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P50549 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y5 | Phosphorylation | Uniprot | |
| K33 | Acetylation | Uniprot | |
| S94 | Phosphorylation | Uniprot | |
| S97 | Phosphorylation | Uniprot | |
| K116 | Acetylation | Uniprot | |
| T139 | Phosphorylation | Uniprot | |
| T143 | Phosphorylation | Uniprot | |
| S146 | Phosphorylation | Uniprot | |
| S191 | Phosphorylation | O75582 (RPS6KA5) , Q15418 (RPS6KA1) , P17612 (PRKACA) , P49137 (MAPKAPK2) | Uniprot |
| S216 | Phosphorylation | P17612 (PRKACA) , P49137 (MAPKAPK2) , O75582 (RPS6KA5) , Q15418 (RPS6KA1) | Uniprot |
| S334 | Phosphorylation | P17612 (PRKACA) , Q15418 (RPS6KA1) | Uniprot |
| Y410 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.
Sumoylated.
Phosphorylated at Ser-191 and Ser-216 by RPS6KA1 and RPS6KA5; phosphorylation activates transcriptional activity.
Nucleus.
Very highly expressed in brain, highly expressed in testis, lung and heart, moderately in spleen, small intestine, pancreas and colon, weakly in liver, prostate and thymus, very weakly in skeletal muscle, kidney and ovary and not in placenta and peripheral blood leukocytes.
Belongs to the ETS family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.