HOXA1 Antibody - #DF3187

Product: | HOXA1 Antibody |
Catalog: | DF3187 |
Description: | Rabbit polyclonal antibody to HOXA1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 37 KD; 37kD(Calculated). |
Uniprot: | P49639 |
RRID: | AB_2835410 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3187, RRID:AB_2835410.
Fold/Unfold
BSAS; Homeo box A1; Homeobox 1F; Homeobox A1; Homeobox protein Hox A1; Homeobox protein Hox-1F; Homeobox protein Hox-A1; Hox 1.6 like protein; Hox 1F; HOX A1; HOX A1 homeodomain protein; HOX1; HOX1F; hoxa1; hoxb1b; HXA1_HUMAN; Lab like protein; MGC45232;
Immunogens
- P49639 HXA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49639 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y28 | Phosphorylation | Uniprot | |
S30 | Phosphorylation | Uniprot | |
T255 | Phosphorylation | Uniprot | |
S296 | Phosphorylation | Uniprot | |
T299 | Phosphorylation | Uniprot | |
S334 | Phosphorylation | Uniprot |
Research Backgrounds
Sequence-specific transcription factor (By similarity). Regulates multiple developmental processes including brainstem, inner and outer ear, abducens nerve and cardiovascular development and morphogenesis as well as cognition and behavior. Also part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments (By similarity). Activates transcription in the presence of PBX1A and PKNOX1 (By similarity).
Nucleus.
Interacts with OGT (via TPR repeats domain); the interaction takes place mainly in the nucleus.
Belongs to the Antp homeobox family. Labial subfamily.
References
Application: IF/ICC Species: Mouse Sample:
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.